You Searched For: Anaspec Inc

Description: Quinine sulfate

Catalog Number: 103010-740

Supplier: Anaspec Inc

Sale

Description: Beta-Secretase Inhibitor 1

Catalog Number: 102999-752

Supplier: Anaspec Inc

Sale

Description: Human Beta-Amyloid (2-40)

Catalog Number: 102997-266

Supplier: Anaspec Inc

Sale

Description: ClearPoint™ Human beta-Amyloid (1-42)

Catalog Number: 103007-700

Supplier: Anaspec Inc

Sale

Description: Histone Deacetylase Substrate, AMC (7-Amino-4-Methylcoumarin)

Catalog Number: 103007-068

Supplier: Anaspec Inc

Sale

Description: 6 - TAMRA, Special Formulation, purified single isomer, Synonym: 6-Carboxytetramethylrhodamine, Molecular Weight: 430.45 (Free Acid), Spectral Properties: Abs/Em = 541/568 nm, Solvent System: DMF or DMSO, Storage -20 degree C, Size: 100 mg

Catalog Number: 103010-842

Supplier: Anaspec Inc

Sale

Description: SensoLyte* AFC Thrombin Activity Assay Kit *Fluorimetric*, Components: AFC Thrombin substrate 5 mM, 50 uL, AFC 5 mM, 10 uL, 2X Assay buffer 20 mL, Purified human thrombin enzyme 0.01 mg/mL, 40 uL, Thrombin inhibitor 10 mM, 10 uL, Stop solution 5 mL

Catalog Number: 103010-468

Supplier: Anaspec Inc

Sale

Description: Histone H4 (8-25)-WC

Catalog Number: 103008-684

Supplier: Anaspec Inc

Sale

Description: [Lys(Me3)4]-Histone H3 (1-21)-GGK,Biotin

Catalog Number: 103008-088

Supplier: Anaspec Inc

Sale

Description: Epitope tag

Catalog Number: 103003-362

Supplier: Anaspec Inc

Sale

Description: Histone H3 (5-23)

Catalog Number: 103009-012

Supplier: Anaspec Inc

Sale

Description: Glucagon - Like Peptide 1, GLP - 1 amide, human, HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2, Peptide Purity: >95%, Molecular Weight: 4111.5, Appearance: Lyophilized white powder, Storage: –20 deg C or lower, Size: 0.5mg

Catalog Number: 102999-326

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)27]-Histone H3 (23-34), H3K27(Ac), Purity: HPLC >/= 95%, MW: 1156.3, Sequence: [KAAR-K(Ac)-SAPATGG] This is histone H3 (23-34) with acetylation at Lys27. Associated with histone deposition in replicating chromatin. Store: -20 deg C, Size: 1mg

Catalog Number: 103009-498

Supplier: Anaspec Inc

Sale

Description: Protease-Activated Receptor-1, PAR-1 Antagonist MW: 922.1, Sequence: YFLLRNP-OH] The peptide YFLLRNP is an antagonist to thrombin and SFLLRNP (thrombin receptor agonist peptide) in human platelets. Apperance: Off white solid, Store: -20 deg C, Size: 1mg

Catalog Number: 103010-016

Supplier: Anaspec Inc

Sale

Description: [Lys(Me1)27/36]-Histone H3 (21-44)-GK(Biotin), H3K27(Me1)K36(Me1), Purity: HPLC >/= 95%, MW: 2946.5, Sequence: [ATKAAR-K(Me1)-SAPATGGV-K(Me1)-KPHRYRPG-GK(Biotin] This peptide is Histone 3 amino acid residues 21 to 44. Store: -20 deg C, Size: 1g

Catalog Number: 103009-844

Supplier: Anaspec Inc

Sale

Description: Vasoactive Intestinal Peptide, human, porcine, rat, Purity: HPLC >/= to 95%, Molecular Weight: 3684.2, Sequence: FAM-HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2, label: FAM, This is a fluorescent (FAM)-labeled VIP, Abs/Em=492/518 nm, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-398

Supplier: Anaspec Inc

Sale