You Searched For: Anaspec Inc

Description: Beta - Synuclein (1 - 134) Recombinant protein, Source: Human, Purity: Greater than 95%(SDS-PAGE). Endotoxin (EU/ug): Less than 1 EU per 1 ug of the protein as determined by Limulus Amebocyte Lysate (LAL), quantitative kinetic assay, Size: 0.1mg

Catalog Number: 103004-986

Supplier: Anaspec Inc

Sale

Description: Recombinant DJ-1 (PARK7) Protein, Human, Purity: >95% SDS-PAGE, molecular weight: 19.9 kD, The recombinant DJ-1 protein was purified from bacterial lysate using GST affinity chromatography, Applications: ELISA, WB, Protease Activity, size: 10 ug

Catalog Number: 103010-646

Supplier: Anaspec Inc

Sale

Description: [Arg(Me2a)8]-Histone H3(1-21)-K(Biotin), H3R8(Me2a), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2636.1, Sequence: ARTKQTA-R(Me2a)-KSTGGKAPRKQLA-K(Biotin)-NH2, Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-616

Supplier: Anaspec Inc

Sale

Description: 5-FAM-KRREILSRRPSYR, Purity: HPLC >/- 95%, Molecular Weight: 2075.3, Appearance: Lyophilized yellow powder, Storage: -20 deg C, size: 1 mg

Catalog Number: 103003-136

Supplier: Anaspec Inc

Sale

Description: [Lys(Me2)18]-Histone H3 (1-21)-GGK(Biotin), H3K18(Me2), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2750.2, Sequence: ARTKQTARKSTGGKAPR-K(Me2)-QLA-GGK(Biotin)-NH2, Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-322

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)12]-Histone H4 (1-21)-GGK(Biotin), H4K12(Ac), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2644.1, Sequence: Ac-SGRGKGGKGLG-K(Ac)-GGAKRHRKVGG-K(Biotin), Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-544

Supplier: Anaspec Inc

Sale

Description: P70 S6 Kinase Substrate, Sequence: KKRNRTLTV, Purity: By HPLC greater than or equal to 95%, This peptide is a substrate for p70 ribosomal S6 kinase, Molecular Weight: 1115.4, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-790

Supplier: Anaspec Inc

Sale

Description: CAP-18, 37 residue peptide is a very effective antimicrobial agent in rabbits, Purity: HPLC >/=95%, Sequence (One-Letter Code): GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY, Molecular weight: 4433.5, Physical State: Lyophilized White Powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-562

Supplier: Anaspec Inc

Sale

Description: SPase I FRET Substrate, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1494.6, Sequence: Dabcyl-AGHDAHASET-Edans, type I signal peptidase substrate peptide labeled with EDANS/ DABCYL FRET pair contains a crucial cleavage, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-586

Supplier: Anaspec Inc

Sale

Description: Oxytocin, Purity: HPLC >/= to 95%, Molecular Weight: 1007.2, Sequence: H-Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Leu-Gly-NH2, is a 9-amino acid peptide that is synthesized primarily in the hypothalamic neurons, specifically the magnocellular oxytocin neurons, Storage: -20 deg C, Size: 25 mg

Catalog Number: 102996-498

Supplier: Anaspec Inc

Sale

Description: Cell Adhesive Peptide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 449.5, Sequence: RGDC, capable of binding to surface Zr alkoxide complexes through alkylcarboxylate intermediates, to stimulate human osteoblast attachment, Storage: -20 deg C, Size: 1mg

Catalog Number: 103008-600

Supplier: Anaspec Inc

Sale

Description: Erktide, peptide substrate for ERK2 (extracellular regulated protein kinase 2) whose activity is regulated by mitogenic stimuli, Purity: HPLC >/= 95%, Sequence (One-Letter Code): IPTTPITTTYFFFK, MW: 1677, Physical State: Lyophilized White Powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-980

Supplier: Anaspec Inc

Sale

Description: Cys(Npys)-(Arg)9, applicable in conjugation and cell permable studies, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): C(Npys)RRRRRRRRR-NH2, Molecular Weight: 1680.1, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-408

Supplier: Anaspec Inc

Sale

Description: PACAP (1-38)-Lys(Biotin), amide, human, ovine, rat, Purity: HPLC >/= 95%, Molecular Weight: 4888.8, Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin)-NH2, Appearance: Solid, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-412

Supplier: Anaspec Inc

Sale

Description: HOE I40

Catalog Number: 102996-350

Supplier: Anaspec Inc

Sale

Description: Human [Thr28, Nle31]-Cholecystokinin (25-33), sulfated

Catalog Number: 102996-332

Supplier: Anaspec Inc

Sale