Print…

You Searched For: Anaspec Inc


2,094  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"2094"

Rate These Search Results

Image Unavailable-102996-230

Human;Rat Neuropeptide Y

Description: Human;Rat Neuropeptide Y
Catalog Number: 102996-230
Supplier: Anaspec Inc
Image Unavailable-102996-168

Human beta-Amyloid (1-42)

Description: Human beta-Amyloid (1-42)
Catalog Number: 102996-168
Supplier: Anaspec Inc
Image Unavailable-103007-284

Cyclo [ - RGDyK(HiLyte* Fluor 750)] 0.1 mg

Description: Cyclo [ - RGDyK(HiLyte* Fluor 750)], Purity: HPLC greater than or equal to 95%, Lyophilized blue powder, peptide is freely soluble in water, Molecular Weight: 1630.5, Storage: -20 deg C, Size: 0.1 mg
Catalog Number: 103007-284
Supplier: Anaspec Inc
Image Unavailable-103007-512

Glutamic Acid Decarboxylase (GAD65) (524-543) p524-543 1 mg

Description: Glutamic Acid Decarboxylase (GAD65) (524-543), p524-543, Sequence: SRLSKVAPVIKARMMEYGTT, Purity: By HPLC >/= 95%, amino acids 524 to 543 fragment of glutamic acid decarboxylase 65, Molecular Weight: 2238.7, Storage: -20 C, Size: 1 mg
Catalog Number: 103007-512
Supplier: Anaspec Inc
Image Unavailable-102996-508

Conantokin G 0.5 mg

Description: Conantokin G, Purity: HPLC >/= 95%, Molecular Weight: 2264.2, Sequence: H-Gly-Glu-Gla-Gla-Leu-Gln-Gla-Asn-Gln-Gla-Leu-Ile-Arg-Gla-Lys-Ser-Asn-NH2, Conantokin G toxin is a 17-amino-acid competitive antagonist of N-methyl-D-aspartate receptors, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102996-508
Supplier: Anaspec Inc
Image Unavailable-102996-128

Laminin Pentapeptide 5 mg

Description: Laminin Pentapeptide, Purity: HPLC >/= to 95%, Molecular Weight: 594.7, Sequence: H-Tyr-Ile-Gly-Ser-Arg-OH, This peptide mediates the attachment, migration and organization of cells into tissues during embryonic development, Storage: -20 deg C, Size: 5 mg
Catalog Number: 102996-128
Supplier: Anaspec Inc
Image Unavailable-103006-540

[Lys(Ac)5] - Histone H4 (1 - 21) - GGK(Biotin) H4K5(Ac) biotin - labeled 1mg

Description: [Lys(Ac)5] - Histone H4 (1-21) - GGK(Biotin), H4K5(Ac), biotin - labeled, Purity: HPLC >/= 95%, Sequence (One-Letter Code): Ac-SGRG-K(Ac)-GGKGLGKGGAKRHRKVGG-K(Biotin), Molecular weight: 2644.1, Storage: -20deg C, Size: 1mg
Catalog Number: 103006-540
Supplier: Anaspec Inc
Image Unavailable-103008-342

[Lys(Me3)20]-Histone H4 (1-23)-GGK(Biotin) H4K20(Me3) 1mg

Description: [Lys(Me3)20]-Histone H4 (1-23)-GGK(Biotin), H4K20(Me3), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2870.4, Sequence: SGRGKGGKGLGKGGAKRHR-K(Me3)-VLR-GGK(Biotin)-NH2, Label: Biotin, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-342
Supplier: Anaspec Inc
Image Unavailable-102997-486

AKT/PKB/Rac - Protein Kinase Substrate 1mg

Description: AKT/PKB/Rac - Protein Kinase Substrate [ARKRERTYSFGHHA], Biotin, Purity: HPLC >/= 95%, Sequence (Three-Letter Code) Bioton - Ala - Arg - Lys - Arg - Glu - Arg - Thr - Tyr - Ser - Phe - Gly - His - His - Ala - OH, MW: 1942.2, Storage: -20deg C, Size: 1mg
Catalog Number: 102997-486
Supplier: Anaspec Inc
Image Unavailable-103006-960

Abltide 1mg

Description: Abltide, peptide substrate for Abl Kinase (Abl protein tyrosine kinase), a partner in the gag-Abl fusion protein of the Abelson murine leukemia virus, Purity: HPLC >/=95%, Sequence(1-Letter Code): KKGEAIYAAPFA-NH2, MW: 1264.5, Form: Lyophilized white powder, Storage: -20C, Size: 1mg
Catalog Number: 103006-960
Supplier: Anaspec Inc
Image Unavailable-102996-410

Parathyroid Hormone (1-34)-Lys(Biotin) 1 mg

Description: Parathyroid Hormone (1-34)-Lys(Biotin), human, Purity: HPLC >/= 95%, Molecular Weight: 4472.2, Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFK(Biotin), Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102996-410
Supplier: Anaspec Inc
Image Unavailable-103008-168

[Lys(Me2)36]-Histone H3 (21-44)-GK(Biotin) H3K36(Me2) 1mg

Description: [Lys(Me2)36]-Histone H3 (21-44)-GK(Biotin), H3K36(Me2), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2945.5, Sequence: ATKAARKSAPATGGV-K(Me2)-KPHRYRPG-GK(Biotin), Label: Biotin, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-168
Supplier: Anaspec Inc
Image Unavailable-103002-994

Keratin K18-C 5mg

Description: Keratin K18-C, Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 1418.5, Sequence: (One-Letter Code) RPVSSAApSVYAGAC
Sequence
(, corresponds to human keratin K18 amino acids 26-38, with an additional C-terminal cysteine, Storage: At -20 degree C, Size: 5mg
Catalog Number: 103002-994
Supplier: Anaspec Inc
Image Unavailable-103008-962

SensoLyte* 520 TACE (Alpha-Secretase) Activity Assay Kit

Description: SensoLyte* 520 TACE (A-Secretase) Activity Assay Kit, Fluorimetric, Contains: QXL* 520, TACE substrate, 5-FAM, fluorescence reference standard, Assay Buffer, Inhibitor of TACE, Stop Solution, Storage: -20 deg C, Size: 100 Assay(96-well plate)
Catalog Number: 103008-962
Supplier: Anaspec Inc
Image Unavailable-103006-080

LSKL Inhibitor of Thrombospondin (TSP - 1) (LSKL - NH2) 1 mg

Description: LSKL, Inhibitor of Thrombospondin (TSP - 1) (LSKL - NH2), Purity: HPLC >/= 95%, Sequence (Three-Letter Code): H - Leu - Ser - Lys - Leu - NH2, Molecular Weight: 458.6, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103006-080
Supplier: Anaspec Inc
Image Unavailable-103010-782

6-FAM, SE 100 mg

Description: 6-FAM, SE, isomer of carboxyfluorescein, CAS Number: 92557-81-8, Synonym: 6-Carboxyfluorescein, succinimidyl ester; 6-FAM, NHS ester, Molecular Weight: 473.39, Molecular Formula: C25H15NO9, Spectral Properties: Abs/Em = 495/517nm, Solvent System: DMF/DMSO, form: Solid, Size: 100 mg
Catalog Number: 103010-782
Supplier: Anaspec Inc
1,441 - 1,456 of 2,094