Human Parathyroid Hormone (1-34)-Lys(Biotin), Biotin

Supplier: Anaspec Inc

AS-23647
102996-410EA 1115.15 USD
102996-410
Human Parathyroid Hormone (1-34)-Lys(Biotin), Biotin
Proteins and Peptides

Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFK(Biotin)
MW: 4472.2 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Order Now


Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR