Print…

You Searched For: Anaspec Inc


2,094  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"2094"

Rate These Search Results

Image Unavailable-102996-506

Substance P 5 mg

Description: Substance P, Purity: HPLC >/= 95%, Molecular Weight: 1347.7, Sequence: H-Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2, Appearance: Powder, Storage: -20 deg C, Size: 5 mg
Catalog Number: 102996-506
Supplier: Anaspec Inc
Image Unavailable-103007-848

Beta-Amyloid (1-40). HFIP Human 1 mg

Description: Beta-Amyloid (1-40). HFIP, Human, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, Purity: By HPLC >/= 95%, Removal of any pre-existing structures in lyophilized stocks of AB-peptide, Molecular Weight: 4329.9, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-848
Supplier: Anaspec Inc
Image Unavailable-103007-444

WRW4, Formyl Peptide Receptor-Like 1 (FPRL1) Antagonist 1 mg

Description: WRW4, Formyl Peptide Receptor-Like 1 (FPRL1) Antagonist, Sequence: WRWWWW, Purity: HPLC >/= 95%, inhibits binding of one of formyl peptide receptor-like 1 agonists WKYMVm to its specific receptor, Molecular Weight: 1105.3, Size: 1 mg
Catalog Number: 103007-444
Supplier: Anaspec Inc
Image Unavailable-103010-510

SensoLyte* Total GSH Assay Kit

Description: SensoLyte* Total GSH Assay Kit*Colorimetric*, Components: Thiol Detection Reagent 1 mL, Reduced Glutathione Standard 10 mM, 200 uL, GSH Reductase 150 uL, NADPH 60 uL, Assay Buffer 100 mL, 5-Sulfosalicylic Acid (SSA) 5 g, storage: -20 deg C
Catalog Number: 103010-510
Supplier: Anaspec Inc
Image Unavailable-103007-614

Beta-Amyloid (1-40)-Lys(Biotin)-NH2 0.1 mg

Description: Beta-Amyloid (1-40)-Lys(Biotin)-NH2, mouse, rat, Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2, Purity: By HPLC >/= 95%, labeled on the N-terminus with HiLyte* Fluor 647, Abs/Em = 649/674 nm, Molecular Weight: 5449.4, Size: 0.1 mg
Catalog Number: 103007-614
Supplier: Anaspec Inc
Image Unavailable-102998-434

ACTH (1 - 10) 5mg

Description: ACTH (1 - 10), Centrally administered N-terminal fragments of ACTH(1-10, 4-10, 4-9), Purity % Peak Area By HPLC >/=95%, Storage: -20 degree Celcius, Physical State: Powder, Sequence (One-Letter Code): SYSMEHFRWG, Molecular Weight: 1299.4,Physical State Powder Size: 5mg
Catalog Number: 102998-434
Supplier: Anaspec Inc
Image Unavailable-103003-542

Biotin - beta - Amyloid (1 - 40) 0.1 mg

Description: Biotin - beta - Amyloid (1 - 40), Human, label: FAM, Purity: HPLC >/- 95%, Molecular Weight: 4556.2, Appearance: Lyophilized white powder, Sequence: FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, FAM is preferred over FITC, Storage -20 deg C, size: 0.1 mg
Catalog Number: 103003-542
Supplier: Anaspec Inc
Image Unavailable-103010-544

SensoLyte* 520 Cathepsin D Assay Kit

Description: SensoLyte* 520 Cathepsin D Assay Kit *Fluorimetric*, Components: Cathepsin D substrate 1 mM, 50 ul, HiLyte Fluor* 488 1 mM, 10 ul, Cathepsin D, bovine spleen 0.1 mg/mL, 10 ul, Assay Buffer 20 mL, Pepstatin A 100 u
M, 20 ul, DTT 1 M, 100 ul, storage: -20 deg C
Catalog Number: 103010-544
Supplier: Anaspec Inc
Image Unavailable-103006-276

CEF Control Peptide Pool 8 mg

Description: CEF Control Peptide Pool, contains 0.25 mg (net) of the 32 CEF peptides, Used in the stimulation of IFNY release from CD8+ T cells in individuals, ELISPOT, intracellular cytokine and CTL assays, Storage: -20 degree C, Size: 8 mg
Catalog Number: 103006-276
Supplier: Anaspec Inc
Image Unavailable-103007-966

[Lys(Me3)4]-Histone H3 (1-21) H3K4(Me3) 1 mg

Description: [Lys(Me3)4]-Histone H3 (1-21), H3K4(Me3), Sequence: ART-K(Me3)-QTARKSTGGKAPRKQLA, Purity: By HPLC >/= 95%, peptide is Histone H3 amino acid residues 1 to 10 tri-methylated at Lys-4, Molecular Weight: 1188.3, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-966
Supplier: Anaspec Inc
Image Unavailable-103007-566

Beta-Amyloid (11-40) FAM-labeled Human 0.1 mg

Description: Beta-Amyloid (11-40), FAM-labeled, Human, Sequence: 5-FAM-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 3510, Apperance: powder, Storage: -20 deg C, Size: 0.1 mg
Catalog Number: 103007-566
Supplier: Anaspec Inc
Image Unavailable-103007-352

Biotin - LC - beta - Amyloid (22 - 41) 1 mg

Description: Biotin - LC - beta - Amyloid (22 - 41), Human, mouse/rat, Purity: HPLC >/= 95%, This is amino acids 22 to 41 fragment of beta-amyloid peptide, biotinylated through an LC spacer, Molecular Weight: 2267.8, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-352
Supplier: Anaspec Inc
Image Unavailable-103007-070

Cathepsin S Substrate 1 mg

Description: Cathepsin S Substrate, Ex/Em=354 nm/442 nm, used to measure cathepsin S activity, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): Ac-KQKLR-AMC, Molecular Weight: 871.1, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103007-070
Supplier: Anaspec Inc
Image Unavailable-103006-512

PLP (139-151) 1 mg

Description: PLP (139-151) peptide is used to induce relapsing-remitting (RR)-EAE model, Purity: HPLC greater than or equal to 95%, Sequence (1-Letter Code): HCLGKWLGHPDKF, (3-Letter Code) H-His-Cys-Leu-Gly-Lys-Trp-Leu-Gly-His-Pro-Asp-Lys-Phe-OH, MW: 1537.8, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-512
Supplier: Anaspec Inc
Image Unavailable-103010-816

5(6)-ROX 100 mg

Description: 5(6)-ROX, Synonym: 5-(and-6)-Carboxy-X-rhodamine, dyes have longer excitation and emission wavelength, used to label peptides, proteins, and other biological ligand, MW: 635.8, Spectral Properties: Abs/Em = 568/591 nm, Solvent System: DMF or DMSO, Storage -20 deg C, Size: 100 mg
Catalog Number: 103010-816
Supplier: Anaspec Inc
Image Unavailable-103011-116

OPA 1 g

Description: OPA, Synonym: o - Phthaldialdehyde, UltraPure Grade, Fluorogenic indicator for primary amino group; Widely used for quantitation of peptides and proteins, Molecular Weight: 134.1, Spectral Properties: Abs/Em = 334/456 nm, Solvent System: DMSO or DMF, CAS: 643-79-8, MF: C8H6O2, Size: 1 g
Catalog Number: 103011-116
Supplier: Anaspec Inc
849 - 864 of 2,094