Mouse;Rat Beta-Amyloid (1-40)-Lys(Biotin)-NH2, Biotin

Supplier: Anaspec Inc

AS-63356
103007-614EA 315.69 USD
103007-614
Mouse;Rat Beta-Amyloid (1-40)-Lys(Biotin)-NH2, Biotin
Proteins and Peptides

This is amino acids 1 to 40 fragment of mouse and rat beta-amyloid differing from human beta-amyloid by three amino acid residues: Gly5, Phe10, and Arg13. This peptide is biotinylated at the C-terminus.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2
Molecular Weight: 4587.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Order Now


Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR