You Searched For: Anaspec Inc

Description: [Lys(Me3)4]-Histone H3 (1-21)-GGK,Biotin

Catalog Number: 103008-088

Supplier: Anaspec Inc

Sale

Description: Epitope tag

Catalog Number: 103003-362

Supplier: Anaspec Inc

Sale

Description: Histone H3 (5-23)

Catalog Number: 103009-012

Supplier: Anaspec Inc

Sale

Description: Glucagon - Like Peptide 1, GLP - 1 amide, human, HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2, Peptide Purity: >95%, Molecular Weight: 4111.5, Appearance: Lyophilized white powder, Storage: –20 deg C or lower, Size: 0.5mg

Catalog Number: 102999-326

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)27]-Histone H3 (23-34), H3K27(Ac), Purity: HPLC >/= 95%, MW: 1156.3, Sequence: [KAAR-K(Ac)-SAPATGG] This is histone H3 (23-34) with acetylation at Lys27. Associated with histone deposition in replicating chromatin. Store: -20 deg C, Size: 1mg

Catalog Number: 103009-498

Supplier: Anaspec Inc

Sale

Description: Protease-Activated Receptor-1, PAR-1 Antagonist MW: 922.1, Sequence: YFLLRNP-OH] The peptide YFLLRNP is an antagonist to thrombin and SFLLRNP (thrombin receptor agonist peptide) in human platelets. Apperance: Off white solid, Store: -20 deg C, Size: 1mg

Catalog Number: 103010-016

Supplier: Anaspec Inc

Sale

Description: [Lys(Me1)27/36]-Histone H3 (21-44)-GK(Biotin), H3K27(Me1)K36(Me1), Purity: HPLC >/= 95%, MW: 2946.5, Sequence: [ATKAAR-K(Me1)-SAPATGGV-K(Me1)-KPHRYRPG-GK(Biotin] This peptide is Histone 3 amino acid residues 21 to 44. Store: -20 deg C, Size: 1g

Catalog Number: 103009-844

Supplier: Anaspec Inc

Sale

Description: Vasoactive Intestinal Peptide, human, porcine, rat, Purity: HPLC >/= to 95%, Molecular Weight: 3684.2, Sequence: FAM-HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2, label: FAM, This is a fluorescent (FAM)-labeled VIP, Abs/Em=492/518 nm, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-398

Supplier: Anaspec Inc

Sale

Description: MBP (87 - 99), human, Purity: Peak Area By HPLC greater than or equal to 95%, Molecular Weight 1555.9, Sequence (One-Letter Code): VHFFKNIVTPRTP, Physical State: Solid, Storage: -20 degree C Store away from oxidizing agent, Size: 1 mg

Catalog Number: 103004-224

Supplier: Anaspec Inc

Sale

Description: 6-Carboxyfluorescein

Catalog Number: 103010-760

Supplier: Anaspec Inc

Sale

Description: [Lys(Me2)9]-Histone H3 (3-17)

Catalog Number: 103008-024

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 570 Generic MMP Assay Kit*Fluorimetric*, Components: 5-TAMRA/QXL* 570 FRET peptide 50 uL, 5-TAMRA 1 mM, 10 uL, APMA 1M, 20 uL, Assay buffer 20 mL, Stop Solution 10 mL, Optimized Performance, Enhanced Value, Assured Reliability, storage: -20 deg C

Catalog Number: 103010-424

Supplier: Anaspec Inc

Sale

Description: [Met5]-Enkephalin, Purity: HPLC >/= 95%, Molecular Weight: 573.8, Sequence: H-Tyr-Gly-Gly-Phe-Met-OH, Appearance: Solid, Storage: -20 deg C, Size: 25 mg

Catalog Number: 102996-550

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 Cathepsin E Assay Kit *Fluorimetric*, Components: QXL* 520/HiLyte Fluor* 488 2 mM, 50uL, HiLyte Fluor* 488 2 mM, 10 uL, Human recombinant Cathepsin E 0.1 mg/mL, 10 uL, Assay Buffer 20 mL, Pepstatin A 10 uM, 20uL, storage: -20 deg C

Catalog Number: 103010-660

Supplier: Anaspec Inc

Sale

Description: AMCA-X, SE, Synonym: 6-((7-Amino-4-methylcoumarin-3-acetyl)amino)hexanoic acid, succinimidyl ester; AMCA-X, NHS ester, blue fluorescent tagging molecules, MW: 443.46, Spectral Properties: Abs/Em = 353/442 nm, Solvent System: DMF or DMSO, Storage -20 deg C, Size: 10 mg

Catalog Number: 103010-896

Supplier: Anaspec Inc

Sale

Description: Cls Substrate, C2 (5-FAM/ QXL* 520), Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): 5-FAM-SLGRKIQIQ-K(QXL* 520)-NH2, Molecular Weight: 2019.2, Physical State: Lyophilized White Powder, Storage: -20 degree C, Size: 0.5 mg

Catalog Number: 103006-568

Supplier: Anaspec Inc

Sale