You Searched For: Anaspec Inc

Description: ACTH (1 - 39), human, cleavage product from a larger precursor proopiomelanocortin (POMC), Purity % Peak Area By HPLC >/=95%, Molecular Weight 4541.1, Sequence (One-Letter Code): SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF, Physical State: Powder, Storage -20 deg C, Size: 1mg

Catalog Number: 102998-422

Supplier: Anaspec Inc

Sale

Description: Bovine B-Casein, monophosphopeptide, for characterization of phosphorylated peptides in liquid chromatography, Purity: HPLC >/=95%, Sequence (1-Letter Code): FQ-pS-EEQQQTEDELQDK, MW: 2062, Form: Lyophilized white powder, Storage: -20degree C, Size: 1mg

Catalog Number: 103006-364

Supplier: Anaspec Inc

Sale

Description: Angiotensin II, human, TAMRA-labeled, Abs/Em = 541/565 nm, Purity: HPLC >/=95%, Sequence (One-Letter Code): TAMRA-DRVYIHPF, Sequence (Three-Letter Code): TAMRA-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-OH, MW: 1458.7, Form: Powder, Storage: -20degree C, Size: 1mg

Catalog Number: 103006-390

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Homogeneous Rh110 Caspase-3/7 Assay Kit, Components: Rh110 Caspase-3/7 substrate 250 ul, Rh110 1 mM DMSO solution, 40 ul, Ac-DEVD-CHO 5 mM DMSO solution, 10 ul, Assay buffer 30 mL, DTT 1 M, 1.1 mL, 10X Lysis Buffer 20 mL

Catalog Number: 103010-170

Supplier: Anaspec Inc

Sale

Description: Histone H3 (1-21), Biotinylated, used to investigate the mechanisms of ethanol-induced histone H3 acetylation in rat hepatocytes, Purity: HPLC >/=95%, Sequence (1-Letter Code): ARTKQTARKSTGGKAPRKQLA-GG-K(BIOTIN)-NH2, MW: 2723.2, Storage: -20degree C, Size: 1mg

Catalog Number: 103006-912

Supplier: Anaspec Inc

Sale

Description: [pSer10), Lys(Ac)14]-Histone H3 (1-21)-GGK(Biotin), biotin-labeled, Sequence: ARTKQTARK-pS-TGG-K(Ac)-APRKQLAGGK(Biotin), Purity: By HPLC >/= 95%,residues 1 to 21 phosphorylated at Ser-10, Molecular Weight: 2845.3, Size: 0.25 mg

Catalog Number: 103007-996

Supplier: Anaspec Inc

Sale

Description: Recombinant human A-Synuclein (1-140), biotin labeled, Source: E. Coli, Purity: Greater than 95% as determined by SDS-PAGE and mass spectrometry, expressed and purified from E. Coli and conjugated with biotin, Storage: -80 degree C, Size: 200ug

Catalog Number: 103001-712

Supplier: Anaspec Inc

Certificates Sale

Description: [Leu27] - Melan - A, MART 1 (26 - 35) (ELAGIGILTV), Purity: HPLC >/= 95%, Sequence (Three-Letter Code): H - Glu - Leu - Ala - Gly - Ile - Gly - Ile - Leu - Thr - Val - OH, MW: 985.8, Physical State: Solid, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-246

Supplier: Anaspec Inc

Sale

Description: Apidaecin IB, Sequence: GNNRPVYIPQPRPPHPRL, Purity: By HPLC >/= 95%, Apidaecin IB is an insect antimicrobial peptide showing a significant sequence homology and a common mechanism of action with drosocin, Molecular Weight: 2108.4, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-152

Supplier: Anaspec Inc

Sale

Description: TAT (47-57), FAM-labeled fluorescent, Absorbance /Em = 494/521 nm, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): FAM-YGRKKRRQRRR, Molecular Weight: 1918.2, Physical State: Solid, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-418

Supplier: Anaspec Inc

Sale

Description: 5(6)-TAMRA, SE, Synonym: 5-(and-6)-Carboxytetramethylrhodamine, succinimidyl ester; 5(6)-TAMRA, NHS ester, for preparing peptide, protein, nucleotide and nucleic acid conjugates, Molecular Weight: 527.53, Molecular Formula: C29H25N3O7, Appearance: Dark red solid, Size: 25mg

Catalog Number: 103010-844

Supplier: Anaspec Inc

Sale

Description: [Pyr3] - beta - Amyloid (3-42), Human, Purity: HPLC >/= 95%, Sequence (One-Letter Code) Pyr-FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, MW: 4309.9, deposited in human brain of Alzheimer's disease & Down's syndrome patients, Storage: -20deg C, Size: 0.1mg

Catalog Number: 102997-272

Supplier: Anaspec Inc

Sale

Description: [Pyr3] - beta - Amyloid (3 - 42), Human, Purity: HPLC >/= 95%, Sequence (One-Letter Code) Pyr-FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, MW: 4309.9, deposited in human brain of Alzheimer's disease and Down's syndrome patients, Storage: -20deg C, Size: 1mg

Catalog Number: 102997-274

Supplier: Anaspec Inc

Sale

Description: Beta - Amyloid (1 - 38), mouse, rat, Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGG, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4035.5, Apperance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-364

Supplier: Anaspec Inc

Sale

Description: Bcl-2 Binding Peptide, Bad BH3 Peptide, Sequence: LWAAQRYGRELRRMSDEFEGSFKGL, Purity: By HPLC >/= 95%,
This is a bcl-2 binding peptide derived from the BH3 domain (a death domain) of Bad, amino acid residues 140 to 165, Molecular Weight: 3003.4, Size: 1 mg

Catalog Number: 103007-830

Supplier: Anaspec Inc

Sale

Description: SensoLyte* HAT (p300) Assay Kit *Fluorimetric*, play major roles in the control of cell fate and their misregulation is implicated in the development of some human tumors, Optimized Performance, Enhanced Value, Assured Reliability, storage: -20 deg C

Catalog Number: 103010-548

Supplier: Anaspec Inc

Sale