You Searched For: Anaspec Inc

Description: Parathyroid Hormone (1-34)-Lys(Biotin), human, Purity: HPLC >/= 95%, Molecular Weight: 4472.2, Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFK(Biotin), Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-410

Supplier: Anaspec Inc

Sale

Description: Laminin Pentapeptide, Purity: HPLC >/= to 95%, Molecular Weight: 594.7, Sequence: H-Tyr-Ile-Gly-Ser-Arg-OH, This peptide mediates the attachment, migration and organization of cells into tissues during embryonic development, Storage: -20 deg C, Size: 5 mg

Catalog Number: 102996-128

Supplier: Anaspec Inc

Sale

Description: Glutamic Acid Decarboxylase (GAD65) (524-543), p524-543, Sequence: SRLSKVAPVIKARMMEYGTT, Purity: By HPLC >/= 95%, amino acids 524 to 543 fragment of glutamic acid decarboxylase 65, Molecular Weight: 2238.7, Storage: -20 C, Size: 1 mg

Catalog Number: 103007-512

Supplier: Anaspec Inc

Sale

Description: Histone H3 (15-36)-GGK(Biotin), Purity: HPLC >/= 95%, Sequence: [APRKQLATKAARKSAPATGGVKGG-K(biotin)] This peptide is Histone H3 amino acid residues 15-36 with a C-terminal GG linker followed by a biotinylated lysine. Store: -20 deg C, Size: 1mg

Catalog Number: 103009-532

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)14]-Histone H3 (1-21)-GGK(Biotin), H3K14(Ac), biotin-labeled, Sequence: ARTKQTARKSTGG-K(Ac)-APRKQLA-GGK(Biotin), Purity: >/= 95%, peptide is Histone H3 amino acid residues 1 to 21 acetylated, Molecular Weight: 2765.3, Size: 1 mg

Catalog Number: 103007-990

Supplier: Anaspec Inc

Sale

Description: R - PE (R - Phycoerythrin), fluorescent protein from phycobiliprotein family, is isolated from red algae, with organic fluorophores, MW: Approximately 240,000, Spectral Properties: Abs/Em = 565/575 nm, Solvent System: Water, Storage: 4 deg C, Size: 1 mg

Catalog Number: 103011-090

Supplier: Anaspec Inc

Sale

Description: [Asn7]-beta-Amyloid (1-40), Tottori-Japanese Mutation, Sequence: DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 4328.9, Apperance: Powder, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 103007-600

Supplier: Anaspec Inc

Sale

Description: NDP-MSH, Purity: HPLC >/- 95%, Molecular Weight: 2017.3, Sequence: 5-TMR-Ser-Tyr-Ser-Nle-Glu-His-D-Phe-Arg-Trp-Gly-Lys-Pro-Val-NH2, label: 5-TAMRA, peptide is fluorescently labeled on the N-terminus, a synthetic analog of alpha-Melanotropin, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103003-236

Supplier: Anaspec Inc

Sale

Description: Leptin (93-105), human, Sequence: NVIQISNDLENLR, Purity: By HPLC greater than or equal to 95%, This is amino acids 93 to 105 fragment of human leptin (anti-obesity protein), Molecular Weight: 1527.7, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-536

Supplier: Anaspec Inc

Sale

Description: 1 - Pyrenebutanoic acid, succinimidyl ester, UVexcitable amino-reactive fluorophore, used to develop ratiometric fluorescent membrane probe, Molecular Weight: 385.42, Spectral Properties: Abs/Em = 340/376 nm, Solvent System: DMF/DMSO, Size: 100 mg

Catalog Number: 103010-922

Supplier: Anaspec Inc

Sale

Description: Histone H3 (1-21), N-Terminal, used as a substrate for methylation and acetylation assays, Purity: HPLC >/=95%, Sequence (One-Letter Code): ARTKQTARKSTGGKAPRKQLA, Molecular weight: 2254.6, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-910

Supplier: Anaspec Inc

Sale

Description: 6-FAM, SE, isomer of carboxyfluorescein, CAS Number: 92557-81-8, Synonym: 6-Carboxyfluorescein, succinimidyl ester; 6-FAM, NHS ester, Molecular Weight: 473.39, Molecular Formula: C25H15NO9, Spectral Properties: Abs/Em = 495/517nm, Solvent System: DMF/DMSO, form: Solid, Size: 100 mg

Catalog Number: 103010-782

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)5] - Histone H4 (1-21) - GGK(Biotin), H4K5(Ac), biotin - labeled, Purity: HPLC >/= 95%, Sequence (One-Letter Code): Ac-SGRG-K(Ac)-GGKGLGKGGAKRHRKVGG-K(Biotin), Molecular weight: 2644.1, Storage: -20deg C, Size: 1mg

Catalog Number: 103006-540

Supplier: Anaspec Inc

Sale

Description: CDK7/9 tide, Sequence: YSPTSPSYSPTSPSYSPTSPSKKKK, Purity: By HPLC greater than or equal to 95%, This is a peptide substrate for CDK7 or CDK9 (cyclin dependent protein kinase), the catalytic subunit of the CDK, Molecular Weight: 2690, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-628

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 TACE (A-Secretase) Activity Assay Kit, Fluorimetric, Contains: QXL* 520, TACE substrate, 5-FAM, fluorescence reference standard, Assay Buffer, Inhibitor of TACE, Stop Solution, Storage: -20 deg C, Size: 100 Assay(96-well plate)

Catalog Number: 103008-962

Supplier: Anaspec Inc

Sale

Description: LSKL, Inhibitor of Thrombospondin (TSP - 1) (LSKL - NH2), Purity: HPLC >/= 95%, Sequence (Three-Letter Code): H - Leu - Ser - Lys - Leu - NH2, Molecular Weight: 458.6, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103006-080

Supplier: Anaspec Inc

Sale