Human [Asn7]-beta-Amyloid (1-40)

Supplier: Anaspec Inc

AS-63320
103007-600EA 454.54 USD
103007-600
Human [Asn7]-beta-Amyloid (1-40)
Proteins and Peptides

Several mutations in the beta amyloid precursor gene cause autosomal dominant Alzheimer's Disease in a number of kindreds. Among them, the Tottori mutation produces beta amyloid peptides with the D7N substitution at the peptide N terminus. This was reported to accelerate the kinetics of oligomers formation which act as fibril seeds and are more toxic to cultured neuronal cells.
Sequence: DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%

Order Now


Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR