You Searched For: Anaspec Inc

Description: 520 MMP FRET Substrate V, Purity: HPLC >/- 95%, Molecular Weight: 1560.6, Sequence: 5-FAM-Pro-Leu-Ala-Nva-Dap(QXL* 520)-Ala-Arg-NH2, A sensitive substrate for assaying MMP-1, 2, 7, 8, 12 and 13 activities, Abs/Em = 494/521 nm, Storage: -20 deg C, size: 0.1 mg

Catalog Number: 103003-246

Supplier: Anaspec Inc

Sale

Description: C-Myc peptide epitope, Purity: HPLC >/= to 95%, Molecular Weight: 1203.3, Sequence: H-Glu-Gln-Lys-Leu-Ile-Ser-Glu-Glu-Asp-Leu-OH, Appearance: Lyophilized white powder, is a helix-loop-helix leucine zipper phosphoprotein, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-474

Supplier: Anaspec Inc

Sale

Description: 5-FAM, single isomer, Synonym: 5-Carboxyfluorescein, Molecular Weight: 376.32, Molecular Formula: C21H12O7, Appearance: Orange solid, Purity: >95% (TLC), >95% (HPLC), Spectral Properties Abs/Em = 492/518 nm, Solvent System DMF or DMSO, Storage: -20 deg C desiccated, Size: 1g

Catalog Number: 103010-756

Supplier: Anaspec Inc

Sale

Description: Neurogranin 28-43 [AAKIQASFRGHMARKK], Biotinylated-LC, Purity: HPLC >/= to 95%, Molecular Weight: 2139.6, Sequence: Biotin-LC-Ala-Ala-Lys-Ile-Gln-Ala-Ser-Phe-Arg-Gly-His-Met-Ala-Arg-Lys-Lys-OH, Appearance: Solid, Storage: -20 deg C, Size: 5 mg

Catalog Number: 102996-878

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Homogeneous AMC Caspase-3/7 Assay Kit, Components: Caspase-3/7 substrate 270 ul, AMC 10 mM DMSO solution, 20 ul, Ac-DEVD-CHO 15 ul, Assay Buffer 30 mL, DTT 1 M, 1 mL, 10X Lysis Buffer 20 mL, with Enhanced Value, storage: -20 deg C

Catalog Number: 103010-138

Supplier: Anaspec Inc

Sale

Description: Human MMP-9 (Recombinant, Catalytic Domain), Matrix metalloproteinases, Source: E. Coli, Purity: Greater than 95% as determined by SDS-PAGE, corresponding to the catalytic domain (aa 112-445), 40 kDa, Storage: -80 degree C, Size: 10ug

Catalog Number: 103001-690

Supplier: Anaspec Inc

Sale

Description: [Lys(Me3)27-Histone H3 (23-34)-GGK, Purity: HPLC >/= 95%, MW: 1624.9, Sequence: [KAAR-K(Me3)-SAPATGGGG-K], trimethylated at Lys27 and biotinylated on the C-terminus through a GGK linker. Re-lyophilized to powder form. Store: -20 deg C, Size: 1mg

Catalog Number: 103009-502

Supplier: Anaspec Inc

Sale

Description: HiLyte* Fluor 555 C2 maleimide, thiol-reactive fluorescent labeling dye that generates the protein conjugates, slightly red-shifted, MW: 1062.3, Spectral Properties: Abs/Em = 552/569 nm, Solvent System: Water or DMF, Form: Solid, Storage -20 deg C, Size: 1 mg

Catalog Number: 103010-940

Supplier: Anaspec Inc

Sale

Description: [Lys(Me1)27]-Histone H3 (21-44)-GK(Biotin), H3K27(Me1), biotin-labeled, Sequence: ATKAAR-K(Me1)-SAPATGGVKKPHRYRPG-GK(Biotin), Purity: By HPLC >/= 95%, residues 21 to 44 mono-methylated at Lys-27, Molecular Weight: 2931.5, Size: 1 mg

Catalog Number: 103008-002

Supplier: Anaspec Inc

Sale

Description: [Lys(Me3)27]-Histone H3 (21-44)-GK(Biotin), H3K27(Me3), biotin-labeled, Sequence: ATKAAR-K(Me3)-SAPATGGVKKPHRYRPG-GK(Biotin), Purity: By HPLC >/= 95%, residues 21 to 44 tri-methylated at Lys-27, Molecular Weight: 2959.5, Size: 1 mg

Catalog Number: 103008-010

Supplier: Anaspec Inc

Sale

Description: [Arg(Me2s)3] - Histone H4 (1-21) - GGK(Biotin); H4R3(Me2s) (1-21), Purity: HPLC >/= 95%, Molecular weight: 2630.1, Sequence One-Letter Code/Three-Letter Code: [Ac-SG-R(me2s)-GKGGKGLGKGGAKRHRKV-GGK(biotin)] Store: -20 deg C, Size: 1mg

Catalog Number: 103009-696

Supplier: Anaspec Inc

Sale

Description: Laminin A1 (2110-2127), amide, mouse, Sequence: CSRARKQAASIKVAVSADR-NH2, Purity: By HPLC greater than or equal to 95%, This peptide is derived from mouse laminin A1 amino acid residues 2110-2127, Molecular Weight: 2016.4, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-796

Supplier: Anaspec Inc

Sale

Description: PDKtide peptide is a substrate for PDK1 (Phosphatidylinositide-Dependent Kinase 1), Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC, Molecular Weight: 4771.4, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-682

Supplier: Anaspec Inc

Sale

Description: PCC (88 - 104), Purity: By HPLC >/= 95%, MW: 1890.2, Sequence: (One-Letter Code): KAERADLIAYLKQATAK17-mer peptide fragment of pigeon cytochrome c that stimulates proliferative T cell responses, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103005-928

Supplier: Anaspec Inc

Sale

Description: Pancreatic Polypeptide, human, Purity: HPLC >/= to 95%, Molecular Weight: 4181.8, Sequence: APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2, is a 36-amino acid anorexigenic peptide hormone secreted by the PP cells of pancreas, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-310

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)27]-Histone H3 (21-43)-GGK(Biotin), H3K27(Ac), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2959.5, Sequence: ATKAAR-K(Ac)-SAPATGGVKKPHRYRPGG-K(Biotin), Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-492

Supplier: Anaspec Inc

Sale