You Searched For: Anaspec Inc

Description: Somatostatin 28, human, sheep, cow, rat, mouse, pig, Purity: HPLC >/= to 95%, Molecular Weight: 3148.6, Sequence: SANSNPAMAPRERKAGCKNFFWKTFTSC, is a cyclic peptide existing in two isoforms and is produced in the pancreas islet, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-328

Supplier: Anaspec Inc

Sale

Description: Gly22]-beta-Amyloid (1-40), Arctic Mutation, Human, Purity: HPLC >/=95%, Sequence (One-Letter Code): DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVV, Molecular weight: 4257.8, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 0.5 mg

Catalog Number: 103006-544

Supplier: Anaspec Inc

Sale

Description: 5(6)-TAMRA, SE, Synonym: 5-(and-6)-Carboxytetramethylrhodamine, succinimidyl ester; 5(6)-TAMRA, NHS ester, for preparing peptide, protein, nucleotide, nucleic acid conjugates, Molecular Weight: 527.53, Molecular Formula: C29H25N3O7, Appearance: Dark red solid, Size: 100 mg

Catalog Number: 103010-846

Supplier: Anaspec Inc

Sale

Description: MOG (35-55), mouse, rat, Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 2582, Sequence: MEVGWYRSPFSRVVHLYRNGK (1-letter code), member of the immunoglobulin superfamily and is expressed in central nervous system (1-3), Storage: At -20 Degree C, Size: 5mg

Catalog Number: 103002-984

Supplier: Anaspec Inc

Sale

Description: SAM PEP 1, FAM labeled, AMPK substrate peptide, FAM labeled, Sequence: 5-FAM-HMRSAMSGLHLVKRR, Purity: HPLC >/= 95%, can be used as a substrate for APK in vitro kinase assays, Molecular Weight: 2137.5, Storage: -20 C, Size: 1 mg

Catalog Number: 103007-732

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Green Protease Assay Kit *Fluorimetric*, Components: Protease substrate 280 ul, Trypsin 5 U/ul, 100 ul, 2X Assay buffer 30 mL, with Convenient Format, Optimized Performance, Enhanced Value, High Speed, Assured Reliability, storage: -20 deg C

Catalog Number: 103010-144

Supplier: Anaspec Inc

Sale

Description: MOG (35-55), mouse, rat, Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 2582, Sequence: MEVGWYRSPFSRVVHLYRNGK (1-letter code), member of the immunoglobulin superfamily and is expressed in central nervous system (1-3), Storage: At -20 Degree C, Size: 10mg

Catalog Number: 103002-982

Supplier: Anaspec Inc

Sale

Description: (Arg)9, biotin-labeled, Sequence: Biotin-LC-RRRRRRRRR-NH2, Purity: By HPLC >/= 95%, peptide sequence with nine arginines contains a biotin group attached to the epsilon amino group of lysine at the N-terminus, Molecular Weight: 1762.2, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-820

Supplier: Anaspec Inc

Sale

Description: Gastrin-1, human, Purity: HPLC >/= 95%, Molecular Weight: 2098.2, Sequence: Pyr-GPWLEEEEEAYGWMDF-NH2, Appearance: Powder, Secretion of gastrin is induced by food intake and causes the release of gastric acid in the stomach, Storage: -20 deg C, Size: 1mg

Catalog Number: 102996-110

Supplier: Anaspec Inc

Sale

Description: [Leu31, Pro34]-Neuropeptide Y, human, rat, Purity: HPLC >/= to 95%, Molecular Weight: 4240.8, Sequence: YPSKPDNPGEDAPAEDMARYYSALRHYINLLTRPRY-NH2Like neuropeptide Y and other peptides of the family, this peptide adopts a folded hairpin structure, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-554

Supplier: Anaspec Inc

Sale

Description: Linear C5a Receptor Antagonist, rat, human, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 886.1, Sequence: FKP-(D-Cha)-Wr, linear peptide is derived from C-terminus of chemokine, complement fragment 5 anaphylatoxin, Storage: -20 deg C, Size: 1mg

Catalog Number: 103008-728

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (1-28), Human, Purity: HPLC >/= to 95%, Molecular Weight: 3262.5, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNK, The three-dimensional solution structure of AB (1-28) reveals the folding of the peptide, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-486

Supplier: Anaspec Inc

Sale

Description: Biotin-TAT (47-57), HIV-derived cell penetrating TAT peptide, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): Biotin-YGRKKRRQRRR, Molecular Weight: 1786.2, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-416

Supplier: Anaspec Inc

Sale

Description: Smac/Diablo Peptide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1555.8, Sequence: AVPIAQKSEK-K(5-FAM)-NH2, Label: 5-FAM labeled, Smac/Diablo Peptide (Abs/Em=492/518 nm), which serves as a Livin inhibitor, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-434

Supplier: Anaspec Inc

Sale

Description: HiLyte* Fluor 594 acid, SE, Synonym: HiLyte* Fluor 594 acid, NHS ester, an alternative to Alexa Fluor* 594 and DyLight Fluor* 594, Molecular Weight 848.94, Spectral Properties: Abs/Em = 593/616 nm, Solvent System: DMF/DMSO, Storage: -20 deg C, Form: Solid, Size: 1 mg

Catalog Number: 103010-956

Supplier: Anaspec Inc

Sale

Description: Crosstide [GRPRTSSFAEG], Purity: HPLC >/- 95%, Molecular Weight: 1522.6, Sequence: 5-FAM-Gly-Arg-Pro-Arg-Thr-Ser-Ser-Phe-Ala-Glu-Gly-OH, label: 5-FAM, It displays similar specificities towards PKBA, PKBB and PKBY isoforms, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103003-134

Supplier: Anaspec Inc

Sale