You Searched For: Anaspec Inc

Description: Gastrin-1, human, Purity: HPLC >/= 95%, Molecular Weight: 2098.2, Sequence: Pyr-GPWLEEEEEAYGWMDF-NH2, Appearance: Powder, Secretion of gastrin is induced by food intake and causes the release of gastric acid in the stomach, Storage: -20 deg C, Size: 1mg

Catalog Number: 102996-110

Supplier: Anaspec Inc

Sale

Description: [Leu31, Pro34]-Neuropeptide Y, human, rat, Purity: HPLC >/= to 95%, Molecular Weight: 4240.8, Sequence: YPSKPDNPGEDAPAEDMARYYSALRHYINLLTRPRY-NH2Like neuropeptide Y and other peptides of the family, this peptide adopts a folded hairpin structure, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-554

Supplier: Anaspec Inc

Sale

Description: Linear C5a Receptor Antagonist, rat, human, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 886.1, Sequence: FKP-(D-Cha)-Wr, linear peptide is derived from C-terminus of chemokine, complement fragment 5 anaphylatoxin, Storage: -20 deg C, Size: 1mg

Catalog Number: 103008-728

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (1-28), Human, Purity: HPLC >/= to 95%, Molecular Weight: 3262.5, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNK, The three-dimensional solution structure of AB (1-28) reveals the folding of the peptide, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-486

Supplier: Anaspec Inc

Sale

Description: Biotin-TAT (47-57), HIV-derived cell penetrating TAT peptide, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): Biotin-YGRKKRRQRRR, Molecular Weight: 1786.2, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-416

Supplier: Anaspec Inc

Sale

Description: Smac/Diablo Peptide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1555.8, Sequence: AVPIAQKSEK-K(5-FAM)-NH2, Label: 5-FAM labeled, Smac/Diablo Peptide (Abs/Em=492/518 nm), which serves as a Livin inhibitor, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-434

Supplier: Anaspec Inc

Sale

Description: HiLyte* Fluor 594 acid, SE, Synonym: HiLyte* Fluor 594 acid, NHS ester, an alternative to Alexa Fluor* 594 and DyLight Fluor* 594, Molecular Weight 848.94, Spectral Properties: Abs/Em = 593/616 nm, Solvent System: DMF/DMSO, Storage: -20 deg C, Form: Solid, Size: 1 mg

Catalog Number: 103010-956

Supplier: Anaspec Inc

Sale

Description: Crosstide [GRPRTSSFAEG], Purity: HPLC >/- 95%, Molecular Weight: 1522.6, Sequence: 5-FAM-Gly-Arg-Pro-Arg-Thr-Ser-Ser-Phe-Ala-Glu-Gly-OH, label: 5-FAM, It displays similar specificities towards PKBA, PKBB and PKBY isoforms, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103003-134

Supplier: Anaspec Inc

Sale

Description: Pluronic* F-127 Cell Culture Tested, Solvent System: Water, Cell culture reagent for dissolving AM esters, CAS Number: 9003-11-6, Physical State: Solid, Storage: -20 degree C, Store away from oxidizing agent, Size: 10 g

Catalog Number: 103011-192

Supplier: Anaspec Inc

Sale

Description: TAT-HA2 Fusion Peptide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 3433, Sequence: RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG, amino acids 1 to 20 of influenza A virus hemagglutinin protein (HA2) connected to a 10 amino acid, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-568

Supplier: Anaspec Inc

Sale

Description: Glucagon-Like Peptide 1, GLP-1 (7-36)-Lys(Biotin), amide, human, Purity: HPLC >/= to 95%, Molecular Weight: 3551.8, Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2solid, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-406

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (11-42), HiLyte* Fluor 488-labeled, Human, Sequence: HiLyte* Fluor 488-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Purity: By HPLC >/= 95%, b-amyloid peptide labeled with HiLyte* Fluor 488, Molecular Weight: 3692.3, Size: 0.1 mg

Catalog Number: 103007-610

Supplier: Anaspec Inc

Sale

Description: [Ala13] - Apelin - 13 (QRPRLSHKGPMPA), Purity: HPLC >/= 95%, Sequence (Three-Letter Code): H - Gln - Arg - Pro - Arg - Leu - Ser - His - Lys - Gly - Pro - Met - Pro - Ala - OH, MW: 1474.7, Physical State: White Powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-336

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (1-28), Human, Purity: HPLC >/= to 95%, Molecular Weight: 3262.5, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNK, The three-dimensional solution structure of AB (1-28) reveals the folding of the peptide, Storage: -20 deg C, Size: 5 mg

Catalog Number: 102996-488

Supplier: Anaspec Inc

Sale

Description: flg22, Flagellin Fragment, Sequence: QRLSTGSRINSAKDDAAGLQIA, Purity: By HPLC >/= 95%, This is 22 amino acids flagellin peptide known as flg2, spans the core domain necessary for binding, Molecular Weight: 2272.5, Apperance: Red Powder, Storage: -20 C, Size: 1 mg

Catalog Number: 103007-440

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Thiol Quantitation Assay Kit *Colorimetric*, Components: Thiol Detection Reagent 1 mL, Reduced Glutathione (GSH) Standard 10 mM, 100 uL, Assay Buffer 100 mL, Optimized Performance, Enhanced Value, Assured Reliability, storage: -20 deg C

Catalog Number: 103010-476

Supplier: Anaspec Inc

Sale