You Searched For: Anaspec Inc

Description: [Lys(Ac)5/8/12/16]-Histone H4 (1-21)-GGK(Biotin), H4K5/8/12/16(Ac), Purity: Greater than or equal to 95%(HPLC), Molecular weight: 2728.2, Sequence: SGRG-K(Ac)-GG-K(Ac)-GLG-K(Ac)-GGA-K(Ac)-RHRKVGG-K(Biotin), Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-528

Supplier: Anaspec Inc

Sale

Description: Resorufin B - D - Galactopyranoside, for sensitive enzyme measurements in ELISA, by flow cytometry and to detect immobilized B-galactosidase activity, Molecular Weight: 375.33, Spectral Properties: Abs/Em = 573/585 nm, Solvent System: DMSO, Size: 25 mg

Catalog Number: 103011-314

Supplier: Anaspec Inc

Sale

Description: Histone H4 (1-23)-GSGSK, C-terminal, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 3003.6, Sequence: SGRGKGGKGLGKGGAKRHRKVLRGSGS-K(Biotin), Label: Biotin, consists of amino acids 1-23 of histone H4, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-532

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 Cathepsin L Assay Kit *Fluorimetric*, Components: QXL* 520/HiLyte Fluor* 488 1 mM, 50 uL, HiLyte Fluor* 488 1 mM, 10 uL, Cathepsin L, 0.1 mg/mL, 20 uL, Assay Buffer 20 mL, Cathepsin L inhibitor 100 uM, 10 uL, DTT 1 M, 200 uL, storage: -20 deg C

Catalog Number: 103010-644

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Anti-Mouse/Rat beta-Amyloid (1-42) Quantitative ELISA Kit, Colorimetric, detect peptide in brain lysate, cerebrospinal fluid/plasma, Wells are pre-coated and blocked with proprietary solution, Storage: 2-8 degree C, Size: One 96-well strip plate

Catalog Number: 103001-640

Supplier: Anaspec Inc

Sale

Description: ?-Calcitonin Gene Related Peptide, A-CGRP, rat, Purity: HPLC >/- 95%, Molecular Weight: 3806.3, Sequence: SCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2, Appearance: Powder, is preferentially expressed in sensory neuron, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103003-360

Supplier: Anaspec Inc

Sale

Description: B8R (20-27), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 960.1, Sequence: TSYKFESV, amino acids 20 to 27 fragment of B8R, a vaccinia virus (VV) gene that encodes a secreted protein related to gamma interferon receptor (IFN), Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-426

Supplier: Anaspec Inc

Sale

Description: [Arg6]-beta-Amyloid (1-40), English Mutation, Sequence: DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Purity: By HPLC greater than or equal to 95%, amino acids 1 to 42 beta-amyloid with the England mutation, Molecular Weight: 4533.2, Size: 0.5 mg

Catalog Number: 103007-606

Supplier: Anaspec Inc

Sale

Description: Histone H4 (8-30)-WGK(Biotin), Purity: HPLC >/= 95%, MW: 3142.7, Sequence: [Ac-KGLGKGGAKRHRKVLRDNIQGIT-WGK(biotin)] This peptide is Histone H4 amino acid residues 8-30 with a C-terminal WG linker, biotin - labeled, Store: -20 deg C, Size: 1mg

Catalog Number: 103009-604

Supplier: Anaspec Inc

Sale

Description: Recombinant human MOG (1 - 125), Source: E.Coli, Purity: Greater than 95% as determined by SDS-PAGE, Endotoxin (EU/ug): Less than 0.1 EU per 1 ug of the protein as determined by Limulus Amebocyte Lysate (LAL) assay, Storage: 2-4 degree Celcius, Size: 1000ug

Catalog Number: 102998-098

Supplier: Anaspec Inc

Sale

Description: LL-37 fragment (18-37), LL-18-37, Sequence: KRIVQRIKDFLRNLVPRTES, Purity: By HPLC greater than or equal to 95%, This is fragment 18-37 of LL-37, it exhibits enhanced antimicrobial activity, Molecular Weight: 2468.9, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-518

Supplier: Anaspec Inc

Sale

Description: Calcitonin Gene Related Peptide, CGRP, human, Purity: HPLC >/= to 95%, Molecular Weight: 3789.4, Sequence: ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2, Appearance: Lyophilized white powder, is a 37-amino acid neuropeptide, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-084

Supplier: Anaspec Inc

Sale

Description: SensoLyte* ADHP Peroxidase Assay Kit, Components: ADHP 10 mM, 250 ul, H2O2 1 vial, Assay buffer 60 mL, with Convenient Format, Optimized Performance, Enhanced Value, High Speed, Assured Reliability, storage: -20 deg C

Catalog Number: 103010-128

Supplier: Anaspec Inc

Sale

Description: Tyrosine Kinase Peptide 1 [KVEKIGEGTYGVVYK], Purity: HPLC >/- 95%, Molecular Weight: 1669.9, Sequence: H-Lys-Val-Glu-Lys-Ile-Gly-Glu-Gly-Thr-Tyr-Gly-Val-Val-Tyr-Lys-OH, Peptide sequence KVEKIGEGTYGVVYK is derived from the amino acid residues CDC26-20, Size: 5 mg

Catalog Number: 103003-222

Supplier: Anaspec Inc

Sale

Description: OVA (329-337), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 925, Sequence: AAHAEINEA; (Three-Letter Code) H - Ala - Ala - His - Ala - Glu - Ile - Asn - Glu - Ala - OH, sequence is OVA (ovalbumin) peptide residues 257 to 280, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-446

Supplier: Anaspec Inc

Sale

Description: SensoLyte* pNPP Alkaline Phosphatase Assay Kit *Colorimetric*, Components: pNPP 25 mL, 10X Assay buffer 50 mL, Stop solution 25 mL, Triton-X-100 500 uL, Alkaline Phosphatase Standard, Calf Intestine 10 ug/mL, 50 uL, storage: -20 deg C

Catalog Number: 103010-494

Supplier: Anaspec Inc

Sale