You Searched For: Anaspec Inc

Description: SensoLyte* Rh110 Plasmin Activity Assay Kit *Fluorimetric*, Components: Plasmin substrate 5 mM, 50 uL, Rh110 5 mM, 10 uL, Human plasmin 250 ug/mL, 10 uL, 2X Assay Buffer 10 mL, Plasmin Inhibitor 1 mM, 10 uL, Stop Solution 5 mL, storage: -20 deg C

Catalog Number: 103010-458

Supplier: Anaspec Inc

Sale

Description: PACAP (6-38), amide, human, ovine, rat, Purity: HPLC >/= to 95%, Molecular Weight: 4024.8, Sequence: FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2, This peptide is a potent antagonist of PACAP 38 and is much more potent and selective than PACAP, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-258

Supplier: Anaspec Inc

Sale

Description: Exendin 4, Purity: HPLC >/- 95%, Molecular Weight: 4186.6, Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, Appearance: Lyophilized white powder, is an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake, Size: 1 mg

Catalog Number: 103003-726

Supplier: Anaspec Inc

Sale

Description: Biotin-X NTA [[Biotin-X nitrilotriacetic acid, tripotassium salt]], Molecular Weight: 716, Appearance: solid, Solvent System: water, Excellent reagent for detecting polyhistidine-containing biomolecules, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103003-304

Supplier: Anaspec Inc

Sale

Description: Di-4-ANEPPS, Fluorescence response less susceptible to cell and tissue types, MW: 480.7, Spectral Properties: Abs/Em = 496/705 nm, Solvent System: Water, Physical State: Solid, Storage -20 deg C, desiccated and protected from light. Store away from oxidizing agent, Size: 5 mg

Catalog Number: 103011-252

Supplier: Anaspec Inc

Sale

Description: Human MMP-12 (Recombinant, Catalytic Domain), Source: E. Coli, Purity: Greater than 95% as determined by SDS-PAGE, Amino acid 106-267, 18 kDa, expressed as catalytic domain, Synonym: Matrix metalloproteinases, Storage: -80 degree C, Size: 10ug

Catalog Number: 103001-346

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (25-35), Human, mouse/rat, Purity: HPLC >/= 95%, Molecular Weight: 1060.3, Sequence: H-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-OH, is the main factor responsible for AB neurotoxic effects, Storage: -20 deg C, Size: 5 mg

Catalog Number: 102996-478

Supplier: Anaspec Inc

Sale

Description: (Arg)9, FAM - labeled (FAM - RRRRRRRRR), cell permeable peptide, Abs/Em = 494/521 nm, Sequence (Three-Letter Code): FAM - Arg - Arg - Arg - Arg - Arg - Arg - Arg - Arg - Arg - OH, Molecular Weight: 1782, Physical State: White Powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-412

Supplier: Anaspec Inc

Sale

Description: Melan-A/MART-1 (27-35), Purity: HPLC >/- 95%, Molecular Weight: 814.6, Sequence: H-Ala-Ala-Gly-Ile-Gly-Ile-Leu-Thr-Val-OH, Appearance: Powder, Melan-A is a melanocyte differentiation antigen recognized by cytotoxic T lymphocytes, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103003-258

Supplier: Anaspec Inc

Sale

Description: PACAP (6-38), amide, human, ovine, rat, Purity: HPLC >/= to 95%, Molecular Weight: 4024.8, Sequence: FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2, This peptide is a potent antagonist of PACAP 38 and is much more potent and selective than PACAP, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-260

Supplier: Anaspec Inc

Sale

Description: Histone H4 (1-7), N-Terminal, Sequence: SGRGKGG, Purity: By HPLC greater than or equal to 95%, This is amino acids 1 to 7 fragment of the histone H3, Molecular Weight: 617.7, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-508

Supplier: Anaspec Inc

Sale

Description: [Gln22, Asn23] - beta - Amyloid (1 - 40), E22Q/D23N Dutch/Iowa double mutation, Human, Sequence: DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4327.9, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 103007-212

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (1-17)-Cys, Human, Sequence: DAEFRHDSGYEVHHQKLC, Purity: HPLC >/= 95%, amino acids 1 to 17 is a modified fragment of the b-amyloid peptide, with cysteine substituted for valine at position 17, Molecular Weight: 2171.3, Storage: -20 C, Size: 1 mg

Catalog Number: 103007-362

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)14/18/23/27]-Histone H3 (1-30)-GGK(Biotin), Purity: HPLC >/= 95%, Molecular weight: 3802.5, Sequence: [ARTKQTARKSTGG-K(Ac)-APR-K(Ac)-QLAT-K(Ac)-AAR-K(Ac)-SAPGG-K(Biotin)], C-terminal GG linker followed by a biotinylated Lys. Size: 1mg

Catalog Number: 103009-090

Supplier: Anaspec Inc

Sale

Description: Bax BH3 peptide (55 - 74), wild type, Sequence: STKKLSECLKRIGDELDSNM, Purity: By HPLC >/= 95%, 20–amino acid Bax BH3 peptide (Bax 1) capable of inducing apoptosis in a variety of cell line models, Molecular Weight: 2267.6, Storage: -20 C, Size: 1 mg

Catalog Number: 103007-264

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Rh110 Matriptase Activity Assay Kit, Fluorimetric, Contains: Rh110 Matriptase substrate, Rh110 fluorescence reference standard, Matriptase, human recombinant, Assay Buffer, Leupeptin, Storage: -20 degree C, Size: 100 Assays (96-well plate)

Catalog Number: 103008-976

Supplier: Anaspec Inc

Sale