Gila Exendin 4

Supplier: Anaspec Inc

AS-24463 AS-24464
103003-724EA 445.77 USD
103003-724 103003-726
Gila Exendin 4
Proteins and Peptides

Exendin-4 (Exenatide), an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.
Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 4186.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Order Now


Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR