Human;Sheep;Rat PACAP (6-38), amide

Supplier: Anaspec Inc

AS-22516 AS-22517
102996-258EA 323 USD
102996-258 102996-260
Human;Sheep;Rat PACAP (6-38), amide
Proteins and Peptides

This peptide is a potent antagonist of PACAP 38 and is much more potent and selective than PACAP (6-27) in the inhibition of PACAP-27 stimulated pituitary adenylate cyclase. The Ki values for the inhibition of the enzyme are 7nM and 150 nM, respectively.
Sequence: FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
MW: 4024.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Order Now


Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR