You Searched For: Anaspec Inc

Description: Hyaluronan Inhibitor, Sequence: GAHWQFNALTVR, Purity: By HPLC >/= 95%, 12 amino acids peptide is a hyaluronan inhibitor, high molecular weight glycosaminoglycan expressed abundantly in the extracellular matrix and on cell surfaces, Molecular Weight: 1399.6, Size: 1 mg

Catalog Number: 103007-428

Supplier: Anaspec Inc

Sale

Description: Atrial Natriuretic Peptide (1-28), rat, Purity: HPLC >/= to 95%, Molecular Weight: 3062.5, Sequence: SLRRSSCFGGRIDRIGAQSGLGCNSFRY, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-078

Supplier: Anaspec Inc

Sale

Description: BFGF (119 - 126), Basic Fibroblast Growth Factor, human, bovine, (KRTGQYKL), Purity: HPLC >/= 95%, Sequence (Three-Letter Code): H - Lys - Arg - Thr - Gly - Gln - Tyr - Lys - Leu - OH, MW: 993.2, Physical State: Solid, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-334

Supplier: Anaspec Inc

Sale

Description: Pep-1: Chariot (Non-Covalent Delivery of Peptides and Proteins) peptide carrier for the noncovalent delivery of proteins into cells, Purity: HPLC>/=95%, Sequence (One-Letter Code): KETWWETWWTEWSQPKKKRKV, MW: 2848.3, Size: 1 mg

Catalog Number: 103006-480

Supplier: Anaspec Inc

Sale

Description: MMP Colorimetric Substrate I, Purity: HPLC >/= to 95%, Molecular Weight: 655.9, Sequence: Ac-Pro-Leu-Gly-SCH[CH2CH(CH3)2]-CO-Leu-Gly-OC2H5, Appearance: powder, this peptide is used for the continuous spectrophotometric assay of MMP-2 and MMP-9, Size: 1 mg

Catalog Number: 102996-774

Supplier: Anaspec Inc

Sale

Description: [Lys(Me1)27]-Histone H3 (23-34), H3K27(Me1), Sequence: KAAR-K(Me1)-SAPATGG, Purity: By HPLC >/= 95%, This peptide is Histone H3 amino acid residues 23 to 34 mono-methylated at Lys-27, Molecular Weight: 1128.3, Storage: -20 C, Size: 1 mg

Catalog Number: 103008-030

Supplier: Anaspec Inc

Sale

Description: HiLyte* Fluor 488 acid, Protein conjugate is prepared, for fluorescein derivatives as FITC, MW: 601.53, Spectral Properties: Abs/Em = 501/527 nm, Solvent System: DMF or DMSO, Physical State: Solid, Storage: -20 deg C, Store away from oxidizing agent, Size: 10 mg

Catalog Number: 103010-872

Supplier: Anaspec Inc

Sale

Description: Endothelin 1, human, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2848.4, Sequence: Fluor 488-CSCSSLMDKECVYFCHLDIIW (Disulfide Bridge: 1-15 & 3-11), Label: HiLyte* Fluor 488, vasoconstrictor peptide from endothelial cells, Storage: -20 degree C, Size: 0.25mg

Catalog Number: 103008-468

Supplier: Anaspec Inc

Sale

Description: Proinsulin C - Peptide (31 - 63), porcine, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): RREAENPQAGAVELGGGLGGLQALALEGPPQKR, Molecular Weight: 3340.7, Physical State: Powder, Storage: -20 degree C, Size: 0.5mg

Catalog Number: 103006-182

Supplier: Anaspec Inc

Sale

Description: HiLyte* Fluor 488 C2 maleimide, thiol-reactive fluorescent labeling dye, that generates the protein conjugates, Molecular Weight: 567.55, Spectral Properties: Abs/Em = 502/527 nm, Solvent System DMF or DMSO, Physical State: Solid, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103010-882

Supplier: Anaspec Inc

Sale

Description: QXL*570 acid, SE, Molecular Weight: 597.77, Solvent System DMSO or DMF, dyes are the optimized quenchers for quenchers for rhodamines and Cy3 fluorophores, Their absorption spectra perfectly overlap with the fluorescence spectra of TAMRA, ROX and Cy3, size: 10 mg

Catalog Number: 103010-228

Supplier: Anaspec Inc

Sale

Description: Atrial Natriuretic Peptide(1-28), Purity: HPLC >/= to 95%, Molecular Weight: 3080.5, Sequence: H-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-GlyAla-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe, Appearance: Lyophilized white powder, Size: 0.5 mg

Catalog Number: 102996-074

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (42-1), Human, Sequence: AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD, Purity: Peak Area By HPLC greater than or equal to 95%, Molecular Weight: 4514.1, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103000-622

Supplier: Anaspec Inc

Sale

Description: Lactoferricin B, Lactoferrin (17-41), Sequence: FKCRRWQWRMKKLGAPSITCVRRAF (S-S BOND), Purity: By HPLC >/= 95%, This is amino acids 17 to 41 fragment of lactoferrin, known as lactoferricin B, Molecular Weight: 3123.9, Storage: -20 C, Size: 1 mg

Catalog Number: 103007-460

Supplier: Anaspec Inc

Sale

Description: Human MMP-1 (Recombinant, Catalytic Domain), Matrix metalloproteinases, Source: E. Coli, Purity: Greater than 95% as determined by SDS-PAGE, corresponding to the catalytic domain (aa 106-261), 17.5 kDa, Storage: -80 degree C, Size: 10ug

Catalog Number: 103001-684

Supplier: Anaspec Inc

Sale

Description: Temporin A, amide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1396.8, Sequence: FLPLIGRVLSGIL-NH2, Appearance: Solid, highly hydrophobic antimicrobial peptide amide derived from the frog Rana temporaria (inducing the migration), Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-474

Supplier: Anaspec Inc

Sale