You Searched For: Anaspec Inc

Description: TIF2 (740 - 753), Transcriptional Intermediary Factor 2 (740 - 753), nuclear receptor (NR) box B3 region of the p160 co-activator Transcriptional Intermediary Factor 2 (TIF2) peptide, a LXXLL motif, Molecular Weight: 1705.9, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-134

Supplier: Anaspec Inc

Sale

Description: 43Gap 26, Connexin Mimetic, Sequence: VCYDKSFPISHVR, Purity: By HPLC greater than or equal to 95%, Gap 26 peptide is derived from the first extracellular loop sequence of connexin (Cx) 43, Molecular Weight: 1550.8, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-452

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (1-39), Purity: HPLC >/= 95%, Molecular Weight: 4230.7, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV, Appearance: Lyophilized white powder, identified as the major components of the cerebral amyloid deposits in Alzheimer’s disease, Size: 1 mg

Catalog Number: 102996-522

Supplier: Anaspec Inc

Sale

Description: 5 - TAMRA, Special Formulation, purified single isomer, Synonym: 5-Carboxytetramethylrhodamine, Molecular Weight: 430.45 (Free Acid), Spectral Properties: Abs/Em = 541/568 nm, Solvent System: DMF or DMSO, Appearance: Dark red solid, Storage -20 deg C, Size: 10mg

Catalog Number: 103010-834

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Rh110 Factor Xa Assay Kit *Fluorimetric*, Components: Rh110 Factor Xa substrate 0.4 mM, 50 uL, Rh110 0.4 mM, 10 uL, Purified Bovine Factor Xa 5 ng/uL, 20 uL, 2X Assay Buffer 25 Ml, Factor Xa Inhibitor 1 mM, 20 uL, storage: -20 deg C

Catalog Number: 103010-622

Supplier: Anaspec Inc

Sale

Description: SensoLyte* pNPP Protein Phosphatase Assay Kit *Colorimetric*, Components: pNPP 1 vial, Assay buffer 60 mL, 10X Lysis buffer 50 mL, Triton X-100 500 uL, Stop solution 30 mL, 1 M DTT 100 uL, with Convenient Format, Enhanced Value, storage: -20 deg C

Catalog Number: 103010-118

Supplier: Anaspec Inc

Sale

Description: [Ser140] - PLP (139 - 151), serine substituted PLP (139-151) causes severe, acute experimental allergic encephalomyelitis in SJL mice, Purity: Peak Area By HPLC >/= 95%, Molecular Weight 1521.8, Sequence (1-Letter Code): HSLGKWLGHPDKF, Storage: -20 deg C, Size: 1mg

Catalog Number: 103004-226

Supplier: Anaspec Inc

Sale

Description: Nuclear Factor (Erythroid-derived 2)like 2 (74-87); Nrf2 (74-87); NFE2L2 (74-87), Purity: HPLC >/= 95%, MW: 1631.8, Sequence: [LQLDEETGEFLPIQ] This peptide is derived from the Neh2 domain of nuclear factor, Store: -20 deg C, Size: 1mg

Catalog Number: 103009-894

Supplier: Anaspec Inc

Sale

Description: Trp63, 64]-C3a (63-77), C-terminal analogue of the complement factor C3a, acts as an agonist to the C3a receptor, Purity: HPLC >/=95%, Sequence (One-Letter Code): WWGKKYRASKLGLAR, Molecular weight: 1820.2, Appearance: Off-White solid, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-230

Supplier: Anaspec Inc

Sale

Description: [Pro18]-Beta-Amyloid (12-28); V8P Beta - Amyloid (12 - 28); ABeta12 - 28P, Human, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1953.2, Sequence: VHHQKLPFFAEDVGSNK, peptide is derived from ABeta (12-28), Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-724

Supplier: Anaspec Inc

Sale

Description: Penetratin, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2360.9, Sequence: RQIKIWFQNRRMKWKKGG, cell-penetrating peptide (CPP), of which the first 16 amino acids are derived from the third helix of the Antennapedia protein homeodomain, Storage: -20 deg C, Size: 1mg

Catalog Number: 103008-578

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (3-42), Human, Sequence: EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 4327.9, Apperance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-526

Supplier: Anaspec Inc

Sale

Description: Lactoferricin B, Lactoferrin (17-41), Sequence: FKCRRWQWRMKKLGAPSITCVRRAF (S-S BOND), Purity: By HPLC >/= 95%, This is amino acids 17 to 41 fragment of lactoferrin, known as lactoferricin B, Molecular Weight: 3123.9, Storage: -20 C, Size: 1 mg

Catalog Number: 103007-460

Supplier: Anaspec Inc

Sale

Description: [Lys(Me1)27]-Histone H3 (23-34), H3K27(Me1), Sequence: KAAR-K(Me1)-SAPATGG, Purity: By HPLC >/= 95%, This peptide is Histone H3 amino acid residues 23 to 34 mono-methylated at Lys-27, Molecular Weight: 1128.3, Storage: -20 C, Size: 1 mg

Catalog Number: 103008-030

Supplier: Anaspec Inc

Sale

Description: Tau Peptide (45-73) (Exon 2/Insert 1 domain), Purity: HPLC >/= 95%, Molecular weight: 2977.97, Sequence: ESPLQTPTEDGSEEPGSETSDAKSTPTAE] TAU proteins belong to the microtubule-associated protein (MAP) family, Store: -20 deg C, Size: 1mg

Catalog Number: 103009-726

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Luminescent Secreted Alkaline Phosphatase Reporter Gene Assay Kit *Luminometric*, is widely used as reporter gene to analyze gene expression, Optimized Performance, Enhanced Value, Assured Reliability, storage: -20 deg C

Catalog Number: 103010-492

Supplier: Anaspec Inc

Sale