Human Beta-Amyloid (3-42)
Supplier: Anaspec Inc
This peptide is beta-amyloid (1-42) N-terminally truncated. It is the non-pyroglatamate form of beta-Amyloid (3-42). N-terminally truncated pyroglutamate-modified beta-Amyloid forms such as Aß(3-42) and Aß (11- 42) have been described as major compounds in the senile plaques. Pyro-Glu modified beta-Amyloid forms are more resistant to degradation, show higher toxicity and have increased aggregation propensity compared to non-modified beta-Amyloid.
Sequence: EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4327.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Learn more

About VWR
Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...