You Searched For: Anaspec Inc

Description: [Lys(Ac)9]-Histone H3 (1-24), H3K9(Ac), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2597, Sequence: ARTKQTAR-K(Ac)-STGGKAPRKQLATKA, Histone 3 peptide is acetylated at lysine residue at 9th position, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-178

Supplier: Anaspec Inc

Sale

Description: Laurdan

Catalog Number: 103011-374

Supplier: Anaspec Inc

Sale

Description: Human Beta-Amyloid (1-42)

Catalog Number: 102996-054

Supplier: Anaspec Inc

Sale

Description: Bovine P2 (53-78)

Catalog Number: 103009-986

Supplier: Anaspec Inc

Sale

Description: Human Beta-Amyloid (1-42), Biotin

Catalog Number: 103006-508

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 FRET SIRT2 Assay Kit *Fluorimetric*, Components: SIRT2 520 FRET substrate 1 mM, 50 ul, Deacetylated FRET 1 mM, 20 ul, SIRT2, 1 mg/mL, 10 ul, Assay Buffer 20 mL, NAD+ 100 mM, 50 ul, Nicotinamide 30 m?, 0.5 mL, SIRT2 Developer (10X) 0.5 mL

Catalog Number: 103010-588

Supplier: Anaspec Inc

Sale

Description: DACM, Synonym: N-(7-Dimethylamino-4-methylcoumarin-3-yl)maleimide, blue fluorescent thiol-reactive reagent that is widely used for probing configurations of biomolecules such as proteins, MW: 298.3, Spectral Properties: Abs/Em = 383/463 nm, Solvent System: DMSO, Size: 10 mg

Catalog Number: 103010-978

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (1-22), Human, Sequence: DAEFRHDSGYEVHHQKLVFFAE, Purity: By HPLC greater than or equal to 95%, This is amino acids 1 to 22 fragment of the beta-amyloid peptide, Molecular Weight: 2661.9, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-582

Supplier: Anaspec Inc

Sale

Description: HIF-1 {alpha} (556-574), hypoxia-inducible factor-1 (HIF-1 a) 19-mer fragment, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): DLDLEMLAPYIPMDDDFQL, MW: 2254.6, Physical State: Lyophilized White Powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-808

Supplier: Anaspec Inc

Sale

Description: Neutrophil elastase Substrate, AFC (Antibody-fluorophore conjugate)

Catalog Number: 102996-448

Supplier: Anaspec Inc

Sale

Description: [Lys(Me1)79]-Histone H3 (69-89)-K,Biotin

Catalog Number: 103008-226

Supplier: Anaspec Inc

Sale

Description: Histone H3 (21-44)-GK, Biotin

Catalog Number: 103008-158

Supplier: Anaspec Inc

Sale

Description: Human;Mouse;Rat Beta-Amyloid (17-40)

Catalog Number: 102999-342

Supplier: Anaspec Inc

Sale

Description: QXL*570 acid, SE, Molecular Weight: 597.77, Solvent System DMSO or DMF, dyes are the optimized quenchers for quenchers for rhodamines and Cy3 fluorophores, Their absorption spectra perfectly overlap with the fluorescence spectra of TAMRA, ROX and Cy3, size: 10 mg

Catalog Number: 103010-228

Supplier: Anaspec Inc

Sale

Description: Atrial Natriuretic Peptide(1-28), Purity: HPLC >/= to 95%, Molecular Weight: 3080.5, Sequence: H-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-GlyAla-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe, Appearance: Lyophilized white powder, Size: 0.5 mg

Catalog Number: 102996-074

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (42-1), Human, Sequence: AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD, Purity: Peak Area By HPLC greater than or equal to 95%, Molecular Weight: 4514.1, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103000-622

Supplier: Anaspec Inc

Sale