Human Beta-Amyloid (1-42), Biotin

Supplier: Anaspec Inc

AS-61484-01 AS-61484-05
103006-508EA 349.31 USD
103006-508 103006-798
Human Beta-Amyloid (1-42), Biotin
Proteins and Peptides

Biotinylated forms of Aβ are used commonly for interaction studies. Studies have revealed that biotinylation of a lysine at the C-terminus or N-terminal biotinylation of the beta-amyloid peptides influences the secondary structure conformation.
This beta-amyloid 1-42 peptide is biotinylated to a lysine residue attached to the C-terminal end.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-K(Biotin)-NH2
MW: 4867.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Order Now


Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR