You Searched For: Anaspec Inc

Catalog Number: (103008-528)

Supplier: Anaspec Inc

Description: This peptide is histone H4 (1-21), acetylated at lysine 5, 8, 12, and 16. It contains a C-terminal GG linker, followed by a biotinylated Lys. In general, histone H4 acetylation is associated with increased DNA replication during mitosis, although different combinations of acetylation at specific sites are selective for specific processes. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRG-K(Ac)-GG-K(Ac)-GLG-K(Ac)-GGA-K(Ac)-RHRKV-GGK(Biotin)
MW:2728.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-518)

Supplier: Anaspec Inc

Description: This peptide is derived from amino acid residues 372-389 of human p53 tumor suppressor protein and is acetylated at Lys382. It is biotinylated at its N-terminus through a 6-carbon LC linker. Activated p53 functions to induce cell cycle arrest and apoptosis in response to signals such as DNA damage. Acetylation of p53 reduces ubiquitination by MDM2 and increases p53 half-life in vivo.
Sequence:Biotin-LC-KKGQSTSRHK-K(Ac)-LMFKTEG
MW:2473 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-532)

Supplier: Anaspec Inc

Description: This peptide consists of amino acids 1-23 of histone H4 attached at the C-terminal by a GSGS linker to biotinylated lysine. It is used as a substrate for histone acetyltransferase (HAT) assays. Biotinylation allows the peptide to be captured on streptavidin or agarose beads.
Sequence:SGRGKGGKGLGKGGAKRHRKVLR-GSGSK(Biotin)
MW:3003.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-564)

Supplier: Anaspec Inc

Description: This peptide is the H2-Kd-restricted epitope of Listeriolysin O (LLO), consisting of amino acids 91 to 99. LLO is necessary for Listeria monocytogenes to escape the vacuoles of host cells and enter the cytoplasm during infection. This fragment has been shown to be a potential vaccine candidate against L. monocytogenes by eliciting a CTL response in vivo.
Sequence:GYKDGNEYI
MW:1058.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: This is amino acids 1 to 40 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13 residues in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4233.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103010-534)

Supplier: Anaspec Inc

Description: Cathepsin B is a member

Catalog Number: (103010-520)

Supplier: Anaspec Inc

Description: Glutathione (GSH) is an important antioxidant molecule that functions as a cofactor for a variety of enzymes and is involved in various biological processes

Catalog Number: (103010-514)

Supplier: Anaspec Inc

Description: Histone deacetylase (HDAC) enzymes act as transcriptional repressors of genes through the deacetylation of lysine residues on histone proteins

Catalog Number: (103010-584)

Supplier: Anaspec Inc

Description: This human recombinant SIRT2 is in its active form, and can be used for enzyme activity assays. The recombinant human Sirtuin 2 (GenBank Accession #: NM_030593) with 13-319 amino acids and His tag at its C-terminal was expressed in E. coli. The molecular mass of the enzyme is approximately 35.5 kDa on SDS-PAGE.
Sirtuins comprise a unique class of nicotinamide adenine dinucleotide (NAD+)-dependent deacetylases (class III HDACs) targeting multiple protein substrates.
Sirtuin 1 (SIRT1), the human homolog of yeast Sir2 (Silent Information Regulator 2), is the most studied of the seven members of sirtuin family. SIRT1 have been implicated in several important cellular processes, including genomic stability and DNA repair, p53-mediated apoptosis, adipogenesis, and aging.
Substrates for SIRT2 are not limited to histones but also include various transcription factors and co-regulators that modulate metabolic, cell cycle and cell death related pathways. Human SIRT2 is a cytoplasmic protein that increases in abundance during mitosis and regulates major events of cytokinesis.

Catalog Number: (103010-524)

Supplier: Anaspec Inc

Description: Tissue-type plasminogen activator (tPA) is a serine protease that cleaves pro-enzyme plasminogen into active plasmin

Catalog Number: (103008-200)

Supplier: Anaspec Inc

Description: This GLP-1 (7-36) amide peptide is fluorescently labeled at Tryptophan residue 25 with Fluorescein. This is the same type of fluorescent labeling as in Extendin-4 Flex peptide (Cat# AS-63899). GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37) - Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) - Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIA (Trp-S-FAM)-LVKGR-NH2
MW: 3717.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103008-150)

Supplier: Anaspec Inc

Description: EMP17 is an erythropoietin (EPO)-mimetic peptide. Erythropoietin (EPO) is the hormone involved in red blood cell production, which activates its receptor by binding to the receptor's extracellular domain and presumably dimerizing two receptor monomers to initiate signal transduction. EMP contains two potentially reactive amines, one at the amino terminus of the peptide and one in the side chain of the single lysine within the peptide sequence.
Sequence: TYSCHFGPLTWVCKPQGG
MW: 1981.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103010-952)

Supplier: Anaspec Inc

Description: Spectrally similar to Cy7 dye, HiLyte™ Fluor 750 C2 maleimide is the longest-wavelength thiol-reactive HiLyte™ Fluor dye currently available.

Catalog Number: (103010-946)

Supplier: Anaspec Inc

Description: Spectrally similar to Cy7 dye, HiLyte™ Fluor 750 acid, SE is the longest-wavelength amine-reactive HiLyte™ Fluor dye currently available.

Catalog Number: (103007-370)

Supplier: Anaspec Inc

Description: This GRG containing peptide is amino acids 1 to 20 fragment of histone 4. It is a substrate for human protein-arginine methyltransferase 7 (PRMT7), a type II methyltransferase capable of producing symmetrical dimethyl arginine (sDMA) modifications in proteins.
Sequence:SGRGKGGKGLGKGGAKRHRK-NH2
MW:1991.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: This C-terminal biotinylated Aß(1-40) contains a 6-carbon long chain (LC) to provide more accesibility for avidin attachment.