Print…

You Searched For: Anaspec Inc


1,910  results were found

Refine Results Sort by
SearchResultCount:"1910"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-103010-836

5-Carboxytetramethylrhodamine (5-TAMRA) Special Formulation

Supplier: Anaspec Inc
Description: 5-TAMRA is the purified single isomer of 5(6)-TAMRA. It is preferred for some complicated biological applications where reproducibility is more critical than material cost since the minor positional difference between 5-TAMRA and 6-TAMRA might affect some biological properties of the underlying conjugates.

Image Unavailable-103010-872

HiLyte™ Fluor 488 acid fluorescent dye

Catalog Number: (103010-872)
Supplier: Anaspec Inc
Description: Protein conjugates prepared with HiLyte™ Fluor 488 dyes are far superior to conjugates of fluorescein derivatives such as FITC.
Image Unavailable-103010-882

HiLyte™ Fluor 488 C2 maleimide fluorescent dye

Catalog Number: (103010-882)
Supplier: Anaspec Inc
Description: HiLyte™ Fluor 488 C2 maleimide is an excellent thiol-reactive fluorescent labeling dye that generates the protein conjugates far superior to those of fluorescein derivatives such as FITC.
Image Unavailable-103010-878

HiLyte™ Fluor 488 amine, TFA salt fluorescent dye

Catalog Number: (103010-878)
Supplier: Anaspec Inc
Description: HiLyte™ Fluor 488 amine is a carbonyl-reactive fluorescent labeling dye.
Image Unavailable-102996-520

Human Beta-Amyloid (1-39)

Supplier: Anaspec Inc
Description: A number of Aß protein variants, differing only at their carboxy terminus (1-39, 1-40, 1-42 and 1-43), are identified as the major components of the cerebral amyloid deposits in Alzheimer’s disease. The length of the C-terminus is a critical determinant of the rate of amyloid formation (“kinetic solubility”), with only a minor effect on the thermodynamic solubility. Amyloid formation by the kinetically soluble peptides (e.g. 1-39) can be nucleated, or “seeded” by peptides which include the critical C-terminal residues (1-42, 26-42, 26-43, 34-42).
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
Molecular Weight: 4230.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Image Unavailable-103011-070

QXL® 570 C2 maleimide fluorescent dye

Catalog Number: (103011-070)
Supplier: Anaspec Inc
Description: QXL® 570 dyes are optimized quenchers for rhodamines (such as TAMRA, sulforhodamine B, ROX) and Cy3 fluorophores.
Image Unavailable-103009-746

Tau Peptide (337-368) (Repeat 4 Domain)

Catalog Number: (103009-746)
Supplier: Anaspec Inc
Description: TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (337-368) is a 32-amino acid long peptide derived from the Repeat 4 domain.
Sequence:VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN
MW:3467.86 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103009-726

Tau Peptide (45-73) (Exon 2/Insert 1 Domain)

Catalog Number: (103009-726)
Supplier: Anaspec Inc
Description: TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (45-73) is a 29-amino acid long peptide derived from the Exon 2/Insert 1 domain.
Sequence:ESPLQTPTEDGSEEPGSETSDAKSTPTAE
MW:2977.97 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103009-050

[Lys(Ac)16]-Histone H4 (1-25)-GSGSK,Biotin

Catalog Number: (103009-050)
Supplier: Anaspec Inc
Description: This peptide is histone H4 (1-25) with acetylation at Lys16. It is biotinylated through a C-terminal GSGSK linker. Monoacetylation of histone H4 occurs predominantly at Lys16. Loss of monoacetylation at Lys16 is associated with human tumor cells. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRGKGGKGLGKGGA-K(Ac)-RHRKVLRDN-GSGSK(Biotin)
MW:3274.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103006-392

ClearPoint™ Human Ang I Isotope Labeled

Supplier: Anaspec Inc
Description: This peptide is angiontensin I (Ang I) with valine and isoleucine universally labeled with 13C and N. Ang I is a precursor to Ang II, which has been implicated in cardiovascular functions, cell proliferation, fibrosis, and apoptosis. The 10-mer Ang I peptide is converted to Ang II through the cleavage of the Phe8-His9 bond of Ang I by angiotensin-converting enzyme (ACE) or human chymase.

Image Unavailable-103007-460

Human Lactoferricin B

Catalog Number: (103007-460)
Supplier: Anaspec Inc
Description: This is amino acids 17 to 41 fragment of lactoferrin, known as lactoferricin B. This peptide exhibits anti-fungal properties in combination of other anti-fungal agents. Candida Albicans is one of the targets of the lactoferricin B.
Sequence:FKCRRWQWRMKKLGAPSITCVRRAF (S-S BOND)
MW:3123.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-452

43Gap 26, Connexin Mimetic

Catalog Number: (103007-452)
Supplier: Anaspec Inc
Description: This Gap 26 peptide is derived from the first extracellular loop sequence of connexin (Cx) 43. This short mimetic peptide reversibly inhibits the gap junction-dependent propagation of Ca2+ waves between tracheal airway epithelial cells.
Sequence:VCYDKSFPISHVR
MW:1550.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103007-446

37, 40 GAP26, Connexin Mimetic

Catalog Number: (103007-446)
Supplier: Anaspec Inc
Description: This peptide corresponds to the GAP26 domain of the extracellular loop of the major vascular connexins (Cx37, Cx40), designated as 37,40Gap 26 according to Cx homology. It was used to investigate the role of gap junctions in the spread of endothelial hyperpolarizations evoked by cyclopiazonic acid (CPA) through the wall of the rodent iliac artery. The gap junction plaques constructed from Cx37 and Cx40 were abundant in the endothelium. This peptide provides inhibitory effects against subintimal hyperpolarization
Sequence:VCYDQAFPISHIR
MW:1548.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103007-428

Hyaluronan Inhibitor

Catalog Number: (103007-428)
Supplier: Anaspec Inc
Description: This 12 amino acids peptide is a hyaluronan inhibitor (HA), a high molecular weight glycosaminoglycan expressed abundantly in the extracellular matrix and on cell surfaces. This peptide shows specific binding to soluble, immobilized, and cell-associated forms of HA, and it inhibits leukocyte adhesion to HA substrates almost completely.
Sequence:GAHWQFNALTVR
MW:1399.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-408

Human gp100 (25–33) peptide

Catalog Number: (103007-408)
Supplier: Anaspec Inc
Description: This is amino acids 25 to 33 fragment of human melanoma antigen gp100. This H-2Db restricted epitope is recognized by T cells. The gp100-specific, H-2Db-restricted, CD8+ T cells are capable of recognizing B16 melanoma but not normal melanocytes. This peptide was used as an immunogen in multiple cancer immunotherapy studies.
Sequence: KVPRNQDWL
MW: 1155.3 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-103007-426

TNF-alpha Antagonist

Catalog Number: (103007-426)
Supplier: Anaspec Inc
Description: This cyclic peptide is designed to mimic the most critical tumor necrosis factor (TNF) recognition loop on TNF receptor I. It prevents interactions of TNF with its receptor. This TNF antagonist is a useful template for the development of small molecular inhibitors to prevent both inflammatory bone destruction and systemic bone loss in rheumatoid arthritis.
Sequence:YCWSQYLCY (Disulfide bridge: 2-8)
MW:1226.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
65 - 80 of 1,910
no targeter for Bottom