You Searched For: Anaspec Inc

Description: SensoLyte* 520 B-Secretase Assay Kit *Fluorimetric*, Components: ?-secretase substrate 60 ul, HiLyte Fluor* 488 1 mM DMSO solution, 20 ul, ?-secretase Inhibitor 250 u
M, 10 ul, 2X Assay buffer 20 Ml, Stop Solution 10 mL, Human ?-secretase 0.5 mg/mL, 20 ul

Catalog Number: 103010-172

Supplier: Anaspec Inc

Sale

Description: Influenza Virus Control Peptide Pool, peptides have been used in the stimulation of IFNY release from CD8+ T cells in individuals with defined HLA types, Storage: -20 deg C, Size: 3 mg

Catalog Number: 103007-298

Supplier: Anaspec Inc

Sale

Description: [Lys(Me3)79]-Histone H3 (69-89)-K(Biotin), H3K79(Me3), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2876.3, Sequence: RLVREIAQDF-K(Me3)-TDLRFQSSAV-K(biotin), Label: Biotin, Storage: -20 degree C, Size: 0.25mg

Catalog Number: 103008-230

Supplier: Anaspec Inc

Sale

Description: Tetramethylrhodamine - 6 - maleimide, Compared to the 5-isomer, tetramethylrhodamine-6-maleimide, for thiol modifications of nucleotides and nucleic acids, MW: 481.51, Spectral Properties: Abs/Em = 542/568 nm, Solvent System: DMF or DMSO, Size: 5 mg

Catalog Number: 103011-010

Supplier: Anaspec Inc

Sale

Description: 5(6)-FAM, SE, Synonym: 5-(and-6)-Carboxyfluorescein, succinimidyl ester; 5(6)-FAM, NHS ester, Appearance: Orange Powder, Solubility: 1 mmol in 1ml DMF, MW: 473.39, Molecular Formula: C25H15NO9, Spectral Properties: Abs/Em = 494/519 nm, Solvent System: DMF or DMSO, Size: 25mg

Catalog Number: 103010-768

Supplier: Anaspec Inc

Sale

Description: Histone H3 (69-89)-K(Biotin), Purity: HPLC >/= 95%, MW: 2834.3, Sequence: [RLVREIAQDFKTDLRFQSSAV-K(Biotin)] biotinylated through the epsilon side chain of a C-terminal Lys. Provided at >95% peptide purity, biotin - labeled, Store: -20 deg C, Size: 1mg

Catalog Number: 103009-380

Supplier: Anaspec Inc

Sale

Description: HSV-gB2 (498-505) immunodominant epitope gB-8p from herpes simplex virus (HSV) glycoprotein B (gB), Purity: HPLC>/=95%, Sequence (1-Letter Code): SSIEFARL, (3-Letter Code) H-Asn-Glu-Lys-Tyr-Ala-Gln-Ala-Tyr-Pro-Asn-Val-Ser-OH, Molecular weight: 1383.5, Size: 1 mg

Catalog Number: 103006-920

Supplier: Anaspec Inc

Sale

Description: Scrambled-beta-Amyloid (1-42), Human, Purity: HPLC >/= 95%, Molecular Weight: 4514.1, Sequence: AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA, Appearance: White Powder, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-722

Supplier: Anaspec Inc

Sale

Description: FRETS-VWF73 (Fluorescence-Quenching Substrate for ADAMTS-13), Sequence: DRE-Dap(Nma)-APNLVYMVTG-Dpa-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR, Purity: By HPLC >/= 95%, Molecular Weight: 8314.3, Size: 1 mg

Catalog Number: 103007-686

Supplier: Anaspec Inc

Sale

Description: Biotin-Glucagon (1-29), bovine, human, porcine, Purity: HPLC >/- 95%, Molecular Weight: 3709.1, Sequence: Biotin-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT, Glucagon is a peptide hormone secreted from the pancreatic Islet of Langerhans alpha-cells, Size: 0.5 mg

Catalog Number: 103003-076

Supplier: Anaspec Inc

Sale

Description: EGF Receptor Substrate 2 [DADE - pY - LIPQQG], 5 - FAM labeled, derived from an autophosphorylation site (Tyr992) of EGFR, Purity: Peak Area By HPLC >/= 95%, MW: 1686.6, Sequence (1-Letter Code): 5-FAM-DADE-pY-LIPQQG, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103004-432

Supplier: Anaspec Inc

Sale

Description: AMCA-X, SE, Synonym: 6-((7-Amino-4-methylcoumarin-3-acetyl)amino)hexanoic acid, succinimidyl ester; AMCA-X, NHS ester, blue fluorescent tagging molecules, MW: 443.46, Spectral Properties: Abs/Em = 353/442 nm, Solvent System: DMF or DMSO, Storage -20 deg C, Size: 10 mg

Catalog Number: 103010-896

Supplier: Anaspec Inc

Sale

Description: SMAP 29, Sheep Myeloid Antimicrobial Peptide 29 displays high antimicrobial activity against Pseudomonas strains, Purity: HPLC>/=95%, Sequence (One-Letter Code): RGLRRLGRKIAHGVKKYGPTVLRIIRIAG, Molecular weight: 3256, Storage: -20degree C, Size: 1mg

Catalog Number: 103006-564

Supplier: Anaspec Inc

Sale

Description: Biotin - LC - beta - Amyloid (1 - 40), Human, Purity: HPLC >/- 95%, Molecular Weight: 4669.3, Sequence: Biotin-LC-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, This biotinylated AB contains a 6-carbon long chain to provide more accesibility, size: 0.5 mg

Catalog Number: 103003-798

Supplier: Anaspec Inc

Sale

Description: Biotin - beta - Amyloid (1 - 40), Human, Purity: HPLC >/- 95%, Molecular Weight: 4556.2, Appearance: Lyophilized white powder, Sequence: Biotin-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, Storage -20 deg C, size: 0.1 mg

Catalog Number: 103003-538

Supplier: Anaspec Inc

Sale

Description: 40Gap 27, Connexin Mimetic, Sequence: SRPTEKNVFIV, Purity: By HPLC greater than or equal to 95%, This peptide corresponds to the GAP27 domain of the second extracellular loop of dominant vascular connexin, Molecular Weight: 1289.5, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-448

Supplier: Anaspec Inc

Sale