You Searched For: Anaspec Inc

Description: Beta-Amyloid (1-42), Human, Purity: HPLC >/- 95%, Molecular Weight: 4926.6, Sequence: TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, label: TAMRA, Appearance: Lyophilized red powder, Storage: -20 deg C, Size: 0.1 mg

Catalog Number: 103003-166

Supplier: Anaspec Inc

Sale

Description: Prodan, Synonym: 6 - Propionyl - 2 - dimethylaminonaphthalene, Environment-sensitive dye for studying membranes and structures of proteins, MW: 227.3, Spectral Properties: Abs/Em = 363/497 nm, Solvent System: DMF, Molecular Formula: C15H17NO, CAS No: 70504-01-7, Size: 25 mg

Catalog Number: 103011-376

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Green Elastase Assay Kit *Fluorimetric*, Components: 5-FAM/QXL* 520 labeled elastin 250 uL, Elastase, porcine pancreas 0.4 mg/mL, 100 uL (5 vials), 2X Assay Buffer 30 mL, Elastase inhibitor (MeOSuc-Ala-Ala-Pro-ValCMK) 10 mM 50 uL, storage: -20 deg C

Catalog Number: 103010-566

Supplier: Anaspec Inc

Sale

Description: Mant-GTP, 2'-/3'-O-(N'-Methylanthraniloyl)guanosine-5'-O-triphosphate, trisodium salt, Formula: C18H20N6Na3O15P3, Molecular weight: 722.28Spectral Property: Abs/Em - 355/448 nm, fluorescent analog of ATP, detecting nucleotide-protein interaction, Storage: -20 degree C, Size: 500ul

Catalog Number: 103008-100

Supplier: Anaspec Inc

Sale

Description: 5-TMRIA, Synonym: Tetramethylrhodamine-5-iodoacetamide, thiol-selective reactive dyes, used to label proteins via the cysteine residues, Molecular Weight: 569.39, Spectral Properties: Abs/Em = 541/567 nm, Solvent System: DMF or DMSO, Storage: -20 deg C, Physical State: Solid, Size: 5mg

Catalog Number: 103010-986

Supplier: Anaspec Inc

Sale

Description: Cathepsin K substrate, Sequence: Abz - HPGGPQ - EDDnp, Purity: By HPLC greater than or equal to 95%, FRET peptide can be used to monitor selectively cathepsin K activity in physiological fluids, Molecular Weight: 920, Storage: -20 deg C, Size: 0.1 mg

Catalog Number: 103007-314

Supplier: Anaspec Inc

Sale

Description: Syk Kinase Peptide Substrate, biotin-labeled, Sequence: Biotin-KEDPDYEWPSAK-NH2, Purity: By HPLC greater than or equal to 95%, This synthetic peptide is a biotinylated substrate for Syk kinase, Molecular Weight: 1689.9, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-864

Supplier: Anaspec Inc

Sale

Description: Protease-Activated Receptor-3, PAR-3 Agonist, amide, Sequence: SFNGGP-NH2, Purity: By HPLC >/= 95%, peptide is one of the four PAR sub-types, and is acted upon by thrombin, Molecular Weight: 576.6, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-560

Supplier: Anaspec Inc

Sale

Description: TAT (47-57) GGG-Cys(Npys) protein transduction domain of the TAT protein and is synthesized with an activated cysteine residue C(Npys), Purity: HPLC>/=95%, Sequence (One-Letter Code): YGRKKRRQRRRGGG-C(Npys)-NH2, Molecular weight: 1987.3, Storage: -20degree C, Size: 1mg

Catalog Number: 103006-428

Supplier: Anaspec Inc

Sale

Description: [Lys(Me2)20]-Histone H4 (8-30)- WGK(Biotin); H4K20(Me2) (8-30), Purity: HPLC >/= 95%, MW: 3170.7, Sequence: [Ac-KGLGKGGAKRHR-K(Me2)-VLRDNIQGITWG-K(biotin)], amino acid residues 8-30 with a C-terminal WG linker, biotin - labeled, Store: -20 deg C, Size: 1mg

Catalog Number: 103009-612

Supplier: Anaspec Inc

Sale

Description: Protease-Activated Receptor-1, PAR-1 Agonist, amide, Sequence: TFLLRN-NH2, Purity: By HPLC >/= 95%, proteinase activated receptor (PAR-1) belongs to a subfamily of G-protein coupled receptor, Molecular Weight: 761.9, Size: 5 mg

Catalog Number: 103007-558

Supplier: Anaspec Inc

Sale

Description: DABCYL acid, Synonym: 4-((4-(dimethylamino)phenyl)azo)benzoic acid, UltraPure Grade, acceptors for developing FRET-based nucleic acid probes and protease substrates, Molecular Weight: 269.3, Spectral Properties: Abs/Em = 425/none nm, Solvent System: DMF or DMSO, Size: 1g

Catalog Number: 103011-046

Supplier: Anaspec Inc

Sale

Description: BrdU, Synonym: 5 - Bromo - 2’ - deoxyuridine, Biomarker for cell cycle and cell proliferation, MW: 307.1, Spectral Properties: Abs/Em = ND/none nm, Solvent System: DMSO, Form: Solid, MF: C9H11BrN2O5, CAS No: 59-14-3, Storage -20 deg C desiccated and protected from light, Size: 25 mg

Catalog Number: 103011-146

Supplier: Anaspec Inc

Sale

Description: [Lys(Me3)36]-Histone H3 (21-44)-GK(Biotin), H3K36(Me3), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2959.5, Sequence: ATKAARKSAPATGGV-K(Me3)-KPHRYRPG-GK(Biotin), Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-164

Supplier: Anaspec Inc

Sale

Description: [Lys(Me1)4]-Histone H3 (1-21), H3K4(Me1), Purity: Greater than or equal to 95%(HPLC), Molecular weight: 2268.6, Sequence: ART-K(Me1)-QTARKSTGGKAPRKQLA, monomethylated lysine at position 4 of 1-21 amino acid histone H3 peptide, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-186

Supplier: Anaspec Inc

Sale

Description: Bid BH3, FAM labeled, pro-apoptotic member of the 'BH3-only' (BOPS) subset of the BCL-2 family of proteins that constitute a critical control point in apoptosis, Purity: HPLC >/=95%, Sequence(1-Letter Code): 5-FAM-EDIIRNIARHLAQVGDSMDR, MW: 2667.9, Storage: -20C, Size: 1mg

Catalog Number: 103006-924

Supplier: Anaspec Inc

Sale