You Searched For: Anaspec Inc

Description: Histone H4 (1 - 21), p300/CBP Substrate, Sequence: SGRGKGGKGLGKGGAKRHRKV, Purity: By HPLC greater than or equal to 95%, This sequence is amino acids 1 to 21 fragment of the histone 4, Molecular Weight: 2091.5, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-372

Supplier: Anaspec Inc

Sale

Description: Plasmepsin V FRET Substrate, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1751.1, Sequence: Dabcyl-LNKRLLHETQ-EDANS, FRET substrate peptide for Plasmepsin V (PMV) is derived from the conserved PEXEL motif, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-598

Supplier: Anaspec Inc

Sale

Description: 5-FAM, SE, Synonym: 5-Carboxyfluorescein, succinimidyl ester; 5-FAM, NHS ester, Molecular Weight 473.39, Molecular Formula: C25H15NO9, Appearance: Orange solid, Purity: >90% (TLC), >90% (HPLC), Spectral Properties: Abs/Em = 492/518 nm, Solvent System: DMF or DMSO, Size: 10 mg

Catalog Number: 103010-774

Supplier: Anaspec Inc

Sale

Description: GIP (1 - 42), human, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ, Molecular Weight: 4983.6, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1mg

Catalog Number: 103006-438

Supplier: Anaspec Inc

Sale

Description: Autocamtide-2-Related Inhibitory Peptide (AIP); CaMKII Inhibitor, myristoylated, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1708.2, Sequence: Myr-KKALRRQEAVDAL, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-588

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (1-40), Purity: HPLC >/- 95%, Molecular Weight: 5199, Sequence: HiLyte* Fluor 555-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, label: HiLyte Fluor* 555, Appearance: Lyophilized red powder, this is a fluorescent labeled B-Amyloid peptide, Size: 0.1 mg

Catalog Number: 103003-180

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)16]-Histone H4 (1-20), H4K16(Ac), Sequence: SGRGKGGKGLGKGGA-K(Ac)-RHRK, Purity: By HPLC greater than or equal to 95%, Histone 4 peptide is acetylated at lysine 16, Molecular Weight: 2034.4, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-668

Supplier: Anaspec Inc

Sale

Description: Calpain Inhibitor Peptide, B27 - WT, Purity: By HPLC >/= 95%, Molecular Weight: 3136.6, Sequence: (One-Letter Code): DPMSSTYIEELGKREVTIPPKYRELLApotent inhibitor of calpain, Physical State: White Powder, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 103006-034

Supplier: Anaspec Inc

Sale

Description: Angiotensin I Converting Enzyme 2, ACE - 2/Caspase - 1 Substrate, Purity: By HPLC >/= 95%, MW: 1145.2, Sequence: (One-Letter Code): Mca-YVADAPK(Dnp), Physical State: Powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103005-964

Supplier: Anaspec Inc

Sale

Description: Ala - Y - D - Glu - DAP, Purity: >/= 95%, MW: 390.4, Sequence: (One-Letter Code): A-(Y-e)-DAPwith the diaminopimelic acid coupled to the Y-carboxylic acid of the D-isomer of Glu, Appearance: Lyophilized white solid, Storage: -20 degree Celcius, Size: 1 mg

Catalog Number: 103005-974

Supplier: Anaspec Inc

Sale

Description: Kisspeptin-10 (Kp-10), Metastin (45-54), Sequence: YNWNSFGLRF-NH2, Purity: By HPLC greater than or equal to 95%, This peptide sequence is found in residues 45 to 54 of Metastin, Molecular Weight: 1302.5, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-822

Supplier: Anaspec Inc

Sale

Description: Histone H3 (1-50)-GGK, Purity: HPLC >/= 95%, Molecular Weight: 5809.8, Sequence: [ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREGG-K(Biotin)] biotinylated through a C-terminal GGK linker. Re-lyophilized to powder form. Biotin - labeled, Store: -20 deg C, Size: 0.25mg

Catalog Number: 103009-478

Supplier: Anaspec Inc

Sale

Description: Enhanced Green Fluorescent Protein, Purity: HPLC >/= 95%, MW: 1019.1, Sequence: [HYLSTQSAL] H2-Kd-restricted enhanced green fluorescent protein (EGFP)-derived peptide (200-208) and represents a CD8 T cell epitope. Biotin - labeled, Store: -20 deg C, Size: 1mg

Catalog Number: 103009-386

Supplier: Anaspec Inc

Sale

Description: Histone H3 (1-25), amide, mediate the folding of DNA into chromatin, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): ARTKQTARKSTGGKAPRKQLATKAA-NH2, Molecular weight: 2625.1, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103006-914

Supplier: Anaspec Inc

Sale

Description: LyP - 1, Peptide 1, Sequence: CGNKRTRGC (S - S Bonded), Purity: HPLC greater than or equal to 95%, recognizes lymphatics and tumor cells in certain tumors, but not lymphatics in normal tissues, Molecular Weight: 992.2, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-222

Supplier: Anaspec Inc

Sale

Description: LCMV GP61, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2276.5, Sequence: GLNGPDIYKGVYQFKSVEFD, An H-2Db restricted epitope, this peptide is amino acids 61 to 80 fragment of the lymphocytic choriomeningitis virus (LCMV), Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-236

Supplier: Anaspec Inc

Sale