You Searched For: Anaspec Inc

Description: Endothelin 1, human, Purity: HPLC >/= to 95%, Molecular Weight: 2850.3, Sequence: FAM-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-OH, label: FAM, Appearance: Solid, This is a fluorescent labeled peptide, Abs/Em = 494/521 nm, Size: 0.5 mg

Catalog Number: 102996-804

Supplier: Anaspec Inc

Sale

Description: Fluorescein-Trp25-Exendin-4 (FLEX), Sequence: HGEGTFTSDLSKQMEEEAVRLFIE-(Trp-S-FAM)-LKNGGPSSGAPPPS-NH2, Purity: By HPLC >/= 95%, This peptide is Exendin-4 labeled with fluorescein at Tryptophan residue, Molecular Weight: 4606.4, Storage: -20 C, Size: 0.5 mg

Catalog Number: 103007-804

Supplier: Anaspec Inc

Sale

Description: Beta - Amyloid (1 - 17, Human, Sequence: DAEFRHDSGYEVHHQKL, Purity: By HPLC greater than or equal to 95%, peptide employed in the b-Amyloid solubility studies, Molecular Weight: 2068.2, Apperance: Powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-104

Supplier: Anaspec Inc

Sale

Description: Human MMP - 2, Concentration: 10 ug/mL, Matrix metalloproteinases (MMP’s) belong to a family of secreted or membrane-associated zinc endopeptidases capable of digesting extracellular matrix components, It can be used as a positive control, Storage: -80 deg C, size: 100 uL

Catalog Number: 103010-278

Supplier: Anaspec Inc

Sale

Description: RS domain derived peptide peptide is a substrate for Clk/Sty and is phosphorylated by Clk/Sty protein kinase (Km=102 microM), Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): GRSRSRSRSR, Molecular weight: 1204.3, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103006-942

Supplier: Anaspec Inc

Sale

Description: Biotin cadaverine [[N-(5-Aminopentyl)biotinamide, trifluoroacetic acid salt]], Molecular Weight: 442.5, Appearance: solid, Solvent System: DMSO or DMF, Building block for modifying carboxy and carbonyl groups, substrate for transglutaminase, Storage: -20 deg C, Size: 25 mg

Catalog Number: 103003-300

Supplier: Anaspec Inc

Sale

Description: Recombinant DJ-1 (PARK7) Protein, Human, Purity: >95% SDS-PAGE, molecular weight: 19.9 kD, The recombinant DJ-1 protein was purified from bacterial lysate using GST affinity chromatography, Applications: ELISA, WB, Protease Activity, size: 10 ug

Catalog Number: 103010-646

Supplier: Anaspec Inc

Sale

Description: Beta - Amyloid (1 - 38), Human, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4131.6, Reconstitute by adding 30-50 ul 1%NH4OH to 0.5 mg B-Amyloid (1-38) peptide, Size: 1 mg

Catalog Number: 102999-788

Supplier: Anaspec Inc

Sale

Description: Gelatin, FITC Conjugated, heavily labeled with FITC, and the conjugate is a highly quenched gelatinase/collagenase substrate, Fluorescence: Excitation/Emission wavelength= 495 nm/520 nm, Solvent System: Water, Storage: -20C desiccated/protected from light, Size: 5 mg

Catalog Number: 103011-298

Supplier: Anaspec Inc

Sale

Description: Tetramethylrhodamine - 6 C2 maleimide, alternative to tetramethylrhodamine-6-maleimide, with spectral characteristics, MW: 552.58, MF: C31H28N4O6, Spectral Properties: Abs/Em = 544/572nm, Solvent System: DMF or DMSO, Storage: -20 degree C, Size: 5 mg

Catalog Number: 103011-004

Supplier: Anaspec Inc

Sale

Description: PACAP (1-38)-Lys(Biotin), amide, human, ovine, rat, Purity: HPLC >/= 95%, Molecular Weight: 4888.8, Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin)-NH2, Appearance: Solid, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-412

Supplier: Anaspec Inc

Sale

Description: Syntide-2, Purity: HPLC >/= to 95%, Molecular Weight: 1507.9, Sequence: H-Pro-Leu-Ala-Arg-Thr-Leu-Ser-Val-Ala-Gly-Leu-Pro-Gly-Lys-Lys-OH, Appearance: solid, is a selective substrate for CaM kinase II and protein kinase C, Storage: -20 deg C, Size: 5 mg

Catalog Number: 102996-268

Supplier: Anaspec Inc

Sale

Description: [Arg(Me2a)8]-Histone H3(1-21)-K(Biotin), H3R8(Me2a), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2636.1, Sequence: ARTKQTA-R(Me2a)-KSTGGKAPRKQLA-K(Biotin)-NH2, Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-616

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 Acetylcholinesterase Activity Assay Kit, Fluorimetric, Contains: Acetylcholinesterase Substrate, Human Recombinant, Inhibitor, Acetylthiocholin, Assay Buffer, Storage: -20 degree C, Size: 200 Assay(96-well plate)

Catalog Number: 103008-978

Supplier: Anaspec Inc

Sale

Description: 5-FAM cadaverine, Synonym: Fluorescein-5-carboxamide cadaverine, building block to prepare fluorescent ligands for receptor binding assays, Molecular Weight: 460.48, Spectral Properties: Abs/Em = 494/521 nm, Solvent System: DMF or DMSO, Storage -20 deg C, Size: 10 mg

Catalog Number: 103011-020

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (13-28), Human, used to study the kinetics of B-amyloid formation, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): HHQKLVFFAEDVGSNK, Molecular Weight: 1856.1, Physical State: Powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-994

Supplier: Anaspec Inc

Sale