You Searched For: Anaspec Inc

Description: TAT-HA2 Fusion Peptide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 3433, Sequence: RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG, amino acids 1 to 20 of influenza A virus hemagglutinin protein (HA2) connected to a 10 amino acid, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-568

Supplier: Anaspec Inc

Sale

Description: HBD-1, B-Defensin-1, human, Purity: HPLC >/- 95%, Molecular Weight: 3929.6, Sequence: DHYNCVSSGGQCLYSACPIFTKIQGTCYRGACC, This is a 3.9kDa 36-amino acid peptide called beta-Defensin-1 having a beta sheet with three intramolecular disulfide bonds, Size: 0.1 mg

Catalog Number: 103003-364

Supplier: Anaspec Inc

Sale

Description: (Arg)9 RRRRRRRRR, involves nucleation of transient pores enabling flow of ions, Purity: >95%, Sequence (Three-Letter Code): H - Arg - Arg - Arg - Arg - Arg - Arg - Arg - Arg - Arg - OH, MW: 1423.7, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-406

Supplier: Anaspec Inc

Sale

Description: Crosstide [GRPRTSSFAEG], Purity: HPLC >/- 95%, Molecular Weight: 1522.6, Sequence: 5-FAM-Gly-Arg-Pro-Arg-Thr-Ser-Ser-Phe-Ala-Glu-Gly-OH, label: 5-FAM, It displays similar specificities towards PKBA, PKBB and PKBY isoforms, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103003-134

Supplier: Anaspec Inc

Sale

Description: Glucagon-Like Peptide 1, GLP-1 (7-36)-Lys(Biotin), amide, human, Purity: HPLC >/= to 95%, Molecular Weight: 3551.8, Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2solid, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-406

Supplier: Anaspec Inc

Sale

Description: [pSer10]-Histone H3 (1-21)-GGK(Biotin); H3pS10, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2802.2, Sequence: ARTKQTARK-pS-TGGKAPRKQLA-GGK(Biotin)-NH2, Label: Biotin, Histone H3 (aa 1-21), Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-106

Supplier: Anaspec Inc

Sale

Description: Protegrine-1 (PG-1), amide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2155.7, Sequence: RGGRLCYCRRRFCVCVGR-NH2 (disulfide bridge: 6-15 and 8-13), Protegrin-1 (PG-1) with a modified C-terminal amide, Storage: -20 degree C, Size: 0.5mg

Catalog Number: 103008-470

Supplier: Anaspec Inc

Sale

Description: Noxa BH3, Peptide 1, Sequence: PAELEVECATQLRRFGDKLNFRQKLL, Purity: By HPLC greater than or equal to 95%, peptide belongs to the Bcl-2 family of proteins, Bcl-2 homology 3 (BH3)-only member of this family, Molecular Weight: 3075.6, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-274

Supplier: Anaspec Inc

Sale

Description: S2238, Thrombin Substrate, Sequence: f-Pip-R-pNA, Purity: By HPLC greater than or equal to 95%, This is a chromogenic substrate for thrombin, Abs=405 nm, Molecular Weight: 552.6, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-720

Supplier: Anaspec Inc

Sale

Description: CEF11, Epstein - Barr Virus BMLF1 (280 - 288), GLCTLVAML, HLA A2.1-restricted epitope, Sequence (Three-Letter Code) H - Gly - Leu - Cys - Thr - Leu - Val - Ala - Met - Leu - OH, MW: 920.2, Physical State: Solid, Storage: -20degree C, Size: 1mg

Catalog Number: 102997-158

Supplier: Anaspec Inc

Sale

Description: ACTH (1 - 24), human, Purity: % Peak Area By HPLC >/=95%, Molecular Weight: 2933.5, natural cleavage product from POMC (proopimelanocortin) processing, Sequence (One-Letter Code): SYSMEHFRWGKPVGKKRRPVKVYP, Appearance: Lyophilized white powder, Storage -20 deg C, Size: 5mg

Catalog Number: 102998-426

Supplier: Anaspec Inc

Sale

Description: DNP-X acid, SE, Synonym: 6-(2,4-Dinitrophenyl)aminohexanoic acid, succinimidyl ester; DNP-X acid, NHS ester, amine-reactive FRET quencher paired with Trp or Tyr, Purity: 95%, Molecular Weight: 394.34, Spectral Properties: Abs/Em = 350/none nm, Storage -20 deg C, Size: 25 mg

Catalog Number: 103010-916

Supplier: Anaspec Inc

Sale

Description: Corticotropin Releasing Factor, CRF, ovine, Sequence: SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA - NH2, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4670.4, Apperance: White Powder, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102999-386

Supplier: Anaspec Inc

Sale

Description: A1(I) Collagen (614-639), Type I Collagen A1(I) C-Telopeptide, human, Sequence: SAGFDFSFLPQPPQEKAHDGGRYYRA, Purity: HPLC >/= 95%, inhibitor of collagen fibrillar matrix assembly, Molecular Weight: 2942.2, Size: 1 mg

Catalog Number: 103007-766

Supplier: Anaspec Inc

Sale

Description: Anti-BetaGamma (MPS-Phosducin-like protein C terminus), Purity: HPLC >/= 95%, Molecular Weight: 4601.4, Sequence: AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE, Appearance: Lyophilized white powder, This is a membrane-permeable phosphoducin-like anti-BY peptide, Size: 0.5 mg

Catalog Number: 102996-462

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (1-28), Human, Purity: HPLC >/= to 95%, Molecular Weight: 3262.5, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNK, The three-dimensional solution structure of AB (1-28) reveals the folding of the peptide, Storage: -20 deg C, Size: 5 mg

Catalog Number: 102996-488

Supplier: Anaspec Inc

Sale