Anti-BetaGamma

Supplier: Anaspec Inc

AS-24177 AS-24178
102996-462EA 454.54 USD
102996-462 102996-464
Anti-BetaGamma
Proteins and Peptides

This is a membrane-permeable peptide, whose membrane-permeable sequence (MPS) is derived from the C-terminus of phosducin-like protein.
Sequence:AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE
MW:4601.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Order Now


Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR