You Searched For: Anaspec Inc

Description: SensoLyte* 520 Neprilysin Activity Assay Kit *Fluorimetric*, Components: 5-FAM/QXLTM-520 Neprilysin substrate 1 mM, 50 uL, 5-FAM 1 mM, 15 uL, Recombinant human neprilysin 10 ug/mL, 100 uL, 2X Assay Buffer 30 mL, Inhibitor 0.1 mM, 15 uL

Catalog Number: 103010-662

Supplier: Anaspec Inc

Sale

Description: <i>Staphylococcus aureus</i> Recombinant Protein A (from <i>E. coli</i>), Biotin

Catalog Number: 103010-690

Supplier: Anaspec Inc

Sale

Description: DiSC3(5), Synonym: 3,3'-Dipropylthiadicarbocyanine iodide, Accumulate in cells on hyperpolarized membranes, Molecular Weight: 546.5, Spectral Properties: Abs/Em = 651/675 nm, Solvent System: DMSO, CAS number: 53213-94-8, Molecular formula: C25H27IN2S2, Storage -20C, Size: 100 mg

Catalog Number: 103011-276

Supplier: Anaspec Inc

Sale

Description: Antennapedia Peptide, FAM-labeled, Sequence: 5-FAM-RQIKIWFQNRRMKWKK-NH2, Purity: By HPLC >/= 95%, This peptide is also called penetratin and this product is FAM-labeled with Abs/Em = 492/518 nm, Molecular Weight: 2604.1, Storage: -20 C, Size: 1 mg

Catalog Number: 103007-972

Supplier: Anaspec Inc

Sale

Description: Srctide, biotinylated, Sequence: Biotin-GEEPLYWSFPAKKK-NH2, Purity: By HPLC >/= 95%, peptide substrate for many protein kinases, such as Blk, BTK, cKit, EPHA1, EPHB2, EPHB3, ERBB4, FAK, Flt3, IGF-1R, ITK, Lck, MET, MUSK, Molecular Weight: 1905.3, Size: 1 mg

Catalog Number: 103007-842

Supplier: Anaspec Inc

Sale

Description: BSB, Synonym: (trans,trans) - 1 - Bromo-2,5-bis-(3-hydroxycarbonyl-4-hydroxy)styrylbenzene, Molecular Weight: 481.3, Spectral Properties: Abs/Em = 340/520 nm, Solvent System: DMSO, CAS Number: 56776-28-4, Appearance: powder, derived from the structure of Congo Red, Size: 5 mg

Catalog Number: 103011-378

Supplier: Anaspec Inc

Sale

Description: DEAC, SE, Synonym: 7-Diethylaminocoumarin-3-carboxylic acid, succinimidyl ester, Purity: >/=95% by HPLC, blue fluorescent building block for labeling amine-containing biomolecules, MW: 358.35, Spectral Properties: Abs/Em = 432/472 nm, Solvent System DMF or Acetonitrile, Size: 25 mg

Catalog Number: 103010-900

Supplier: Anaspec Inc

Sale

Description: Beta - Amyloid (1 - 40) - Lys(Biotin - LC), Human, Purity: HPLC >/- 95%, Molecular Weight: 4797.5, Appearance: Lyophilized white powder, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K, contains a 6-carbon long chain, size: 0.1 mg

Catalog Number: 103003-546

Supplier: Anaspec Inc

Sale

Description: Elafin, Purity: HPLC >/= 95%, Sequence (One-Letter Code): AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16- Cys45, Cys23- Cys49, Cys32- Cys44, Cys38-Cys53), MW: 5999.3, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-886

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 MMP-3 Assay Kit * Fluorimetric*, Components: MMP-3 substrate 60 ul, 5-FAM-Pro-Leu-OH 1 mM, 10 ul, APMA 1 M, 20 ul, Assay buffer 20 mL, Stop solution 10 mL, with Convenient Format, Optimized Performance, Enhanced Value, High Speed, Assured Reliability

Catalog Number: 103010-234

Supplier: Anaspec Inc

Sale

Description: Alpha9-Gliadin (57-68), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1455.7, Sequence: QLQPFPQPQLPY, derived from amino acid 57-68 of a9-gliadin and represents an immunodominant epitope, resistant to pancreatic proteolysis, Storage: -20 deg C, Size: 1mg

Catalog Number: 103008-718

Supplier: Anaspec Inc

Sale

Description: O-linked GlcNAc transferase (OGT) Substrate, Sequence: KKKYPGGSTPVSSANMM, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 1783.1, Apperance: powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-532

Supplier: Anaspec Inc

Sale

Description: Orexin A, bovine, human, mouse, rat, Purity: HPLC >/- 95%, Molecular Weight: 3561.2, Sequence: Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103003-738

Supplier: Anaspec Inc

Sale

Description: EMP17, Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 2483.9, Sequence: (One-Letter Code) FITC-LC-TYSCHFGPLTWVCKPQGG, fluorescent (FITC)-labeled Erythropoietin (EPO)-mimetic peptide (EMP17), Abs/Em=494/520 nm, Storage: At -20 Degree C, Size: 1mg

Catalog Number: 103002-744

Supplier: Anaspec Inc

Sale

Description: HCV Protease FRET Substrate (RET S1), Purity: HPLC >/= to 95%, Molecular Weight: 1548.6, Sequence: Ac-DE-D(Edans)-EE-Abu-psi-[COO]-AS-K(Dabcyl)-NH2, Appearance: Lyophilized white powder, is a HCV protease substrate, Storage: -20 deg C, Size: 0.25 mg

Catalog Number: 102996-360

Supplier: Anaspec Inc

Sale

Description: 5-FTSC, Synonym: Fluorescein-5-thiosemicarbazide, reacts with ketones to yield relatively stable hydrazones and with aldehydes to yield hydrazones, Molecular Weight: 421.4, Spectral Properties: Abs/Em = 492/516 nm, Solvent System: DMF or DMSO, Storage: -20 deg C, Size: 25 mg

Catalog Number: 103011-026

Supplier: Anaspec Inc

Sale