Print…

You Searched For: Anaspec Inc


2,094  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"2094"

Rate These Search Results

Image Unavailable-103011-228

DiBAC4(3) 25 mg

Description: DiBAC4(3), Synonym: Bis-(1,3-dibutylbarbituric acid)trimethine oxonol, UltraPure Grade, Sensitive 488 nm-excitable membrane potential probe, MW: 516.6, Spectral Properties: Abs/Em = 493/516 nm, Solvent System: DMSO, Appearance: Red solid, Purity: > 95 % (HPLC), Size: 25 mg
Catalog Number: 103011-228
Supplier: Anaspec Inc
Image Unavailable-103009-158

[Lys(Ac)8]-Histone H4

Description: [Lys(Ac)8]-Histone H4 (1-25)-GSGSK; H4K8(Ac), Purity: HPLC >/= 95%, MW: 3274.8, Sequence: [SGRGKGG-K(Ac)-GLGKGGAKRHRKVLRDNGSGS-K(Biotin)], (1-25) with acetylation at Lys8, biotinylated through a C-terminal GSGSK linker. Biotin - labeled, Store: -20 deg C, Size: 1mg
Catalog Number: 103009-158
Supplier: Anaspec Inc
Image Unavailable-103007-726

Cyclo (RGDfC) avb3 Integrin Binding Cyclic RGD Peptide 1 mg

Description: Cyclo (RGDfC), avb3 Integrin Binding Cyclic RGD Peptide, Sequence: Cyclo(-RGDfC), Purity: By HPLC >/= 95%, This is a cyclic RGDfC sequence, an integrin avb3-affine peptide, Molecular Weight: 578.7, Storage: -20 C, Size: 1 mg
Catalog Number: 103007-726
Supplier: Anaspec Inc
Image Unavailable-103008-018

[Lys(Me2)4]-Histone H3 (1-10) H3K4(Me2) 1 mg

Description: [Lys(Me2)4]-Histone H3 (1-10), H3K4(Me2), Sequence: ART-K(Me2)-QTARKS, Purity: By HPLC greater than or equal to 95%, peptide is Histone H3 amino acid residues 1 to 10 di-methylated at Lys-4, Molecular Weight: 1174.3, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103008-018
Supplier: Anaspec Inc
Image Unavailable-103007-962

[Lys(Ac)9]-Histone H3 (1-21) H3K9(Ac) 1 mg

Description: [Lys(Ac)9]-Histone H3 (1-21), H3K9(Ac), Sequence: ARTKQTAR-K(Ac)-STGGKAPRKQLA, Purity: By HPLC greater than or equal to 95%, peptide sequence is found in residues 1 to 21 of the histone H3K9(Ac), Molecular Weight: 2296.7, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-962
Supplier: Anaspec Inc
Image Unavailable-103011-278

MQAE 100 mg

Description: MQAE, Synonym: N-(Ethoxycarbonylmethyl)-6-methoxyquinolinium bromide, Fluorescent indicator for Cl-, Molecular Weight: 326.2, Spectral Properties: Abs/Em = 350/460 nm, Solvent System: DMSO, CAS number: 162558-52-3, Molecular Formula: C14H16BrNO3, Storage: -20 deg C, Size: 100 mg
Catalog Number: 103011-278
Supplier: Anaspec Inc
Image Unavailable-102999-764

Atrial Natriuretic Peptide (1 - 28) 0.5 mg

Description: Atrial Natriuretic Peptide (1 - 28), human, porcine, Biotin - labeled, Sequence: Biotin - SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7 - 23), Purity: HPLC greater than or equal to 95%, Molecular Weight: 3308.8, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102999-764
Supplier: Anaspec Inc
Image Unavailable-102999-786

Cecropin B 0.5 mg

Description: Cecropin B, Sequence: KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL - NH2, Purity: HPLC greater than or equal to 95%, Molecular Weight: 3834.7, Apperance: Lyophilized white powder,Peptide Reconstitution: Cecropin B peptide is freely soluble in H2O, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102999-786
Supplier: Anaspec Inc
Image Unavailable-103006-352

Cyclo ( - GRGDSP) N to C cyclized 5 mg

Description: Cyclo ( - GRGDSP) N to C cyclized, Purity: HPLC greater than or equal to 95%, Sequence (Three-Letter Code): Cyclo( - Gly - Arg - Gly - Asp - Ser - Pro), Molecular Weight: 569.6, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 5 mg
Catalog Number: 103006-352
Supplier: Anaspec Inc
Image Unavailable-102996-548

[Leu5]-Enkephalin 25 mg

Description: [Leu5]-Enkephalin, Purity: HPLC >/= 95%, Molecular Weight: 555.7, Sequence: H-Tyr-Gly-Gly-Phe-Leu-OH, Appearance: Solid, Storage: -20 deg C, Size: 25 mg
Catalog Number: 102996-548
Supplier: Anaspec Inc
Image Unavailable-103007-296

Cytomegalovirus (CMV) Control Peptide Pool 1.25 mg

Description: Cytomegalovirus (CMV) Control Peptide Pool, peptides have been used in the stimulation of IFNgamma release from CD8+ T cells in individuals with defined HLA types, Storage: -20 deg C, Size: 1.25 mg
Catalog Number: 103007-296
Supplier: Anaspec Inc
Image Unavailable-102996-536

?-Endorphin 1 mg

Description: ?-Endorphin, human, Purity: HPLC >/= 95%, Molecular Weight: 3465.1, Sequence: H-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu-OH, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102996-536
Supplier: Anaspec Inc
Image Unavailable-103010-358

AnaTag* HiLyte* Fluor 647 Protein Labeling Kit

Description: AnaTag* HiLyte* Fluor 647 Protein Labeling Kit *Ultra Convenient* Components: HiLyte Fluor*647 SE 3 vials, Reaction buffer 0.5 Ml, Desalting column 3 Pre-packed columns, DMSO 1 mL, 10X Elution buffer 30 ml, storage: 4 deg C
Catalog Number: 103010-358
Supplier: Anaspec Inc
Image Unavailable-102999-330

Glucagon - Like Peptide 1, GLP - 1 (7 - 36), amide, human 0.5 mg

Description: Glucagon - Like Peptide 1, GLP - 1 (7 - 36), amide, human, HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR - NH2, Purity: Peak Area By HPLC greater than or equal to 95%, Molecular Weight: 3297.7, Storage: -20 deg C, size: 0.5mg
Catalog Number: 102999-330
Supplier: Anaspec Inc
Image Unavailable-103008-716

Histone H4 (1-23)-GGK(Biotin) 1mg

Description: Histone H4 (1-23)-GGK(Biotin), amide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2828.4, Sequence: SGRGKGGKGLGKGGAKRHRKVLRGG-K(Biotin)-NH2, Label: Biotin, Histone H4 (1-23) biotinylated through GGK linker, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-716
Supplier: Anaspec Inc
Image Unavailable-103010-342

SensoLyte* 520 Renin Assay Kit

Description: SensoLyte* 520 Renin Assay Kit*Fluorimetric*, Components: Renin substrate 1.5 mM DMSO solution, 50 ul 5-FAM 1mM, 20 ul, Human recombinant renin 50 ul, Assay buffer 25 mL, Renin Inhibitor Ac-HPFV- (Sta)-LF-NH2 1mM DMSO solution, 4 ul, storage: -20 deg C
Catalog Number: 103010-342
Supplier: Anaspec Inc
1,377 - 1,392 of 2,094