You Searched For: Anaspec Inc


2,094  results were found

Sort Results

List View Easy View
SearchResultCount:"2094"
Description: Histone H3 (1-25), amide, mediate the folding of DNA into chromatin, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): ARTKQTARKSTGGKAPRKQLATKAA-NH2, Molecular weight: 2625.1, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103006-914
Supplier: Anaspec Inc


Description: LyP - 1, Peptide 1, Sequence: CGNKRTRGC (S - S Bonded), Purity: HPLC greater than or equal to 95%, recognizes lymphatics and tumor cells in certain tumors, but not lymphatics in normal tissues, Molecular Weight: 992.2, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-222
Supplier: Anaspec Inc


Description: LCMV GP61, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2276.5, Sequence: GLNGPDIYKGVYQFKSVEFD, An H-2Db restricted epitope, this peptide is amino acids 61 to 80 fragment of the lymphocytic choriomeningitis virus (LCMV), Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-236
Supplier: Anaspec Inc


Description: [Glu1]-Fibrinopeptide B, Purity: HPLC >/- 95%, Molecular Weight: 1570.6, Sequence: H-Glu-Gly-Val-Asn-Asp-Asn-Glu-Glu-Gly-Phe-Phe-Ser-Ala-Arg-OH, Appearance: Lyophilized white powder, This peptide is derived from fibrinopeptide B amino acid residues 1-14, Size: 1 mg
Catalog Number: 103003-184
Supplier: Anaspec Inc


Description: SensoLyte* 520 Cathepsin B Assay Kit *Fluorimetric*, Components: Cathepsin B substrate 2 mM, 50 ul, HiLyte Fluor* 488 1 mM, 10 ul, Cathepsin B enzyme, human liver 5 ul, Assay Buffer 20 mL, Cathepsin B inhibitor Ac-LVK-CHO 100 u
M, 10 ul, DTT 1 M, 100 ul
Catalog Number: 103010-532
Supplier: Anaspec Inc


Description: Streptavidin, Recombinant, Streptavidin is a nonglycosylated tetrameric protein that binds biotin noncovalently and with high affinity, was expressed in E. Coli, It shows one major band about 56 kDa on SDS-PAGE, Apperance: Lyophilized powder, size: 5 mg
Catalog Number: 103010-562
Supplier: Anaspec Inc


Description: Beta-Amyloid Peptide (1-42), mouse, rat, Purity: HPLC >/= to 95%, Molecular Weight: 4418, Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Appearance: Lyophilized off-white powder, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102996-720
Supplier: Anaspec Inc


Description: [Des - octanoyl] - Ghrelin, human, unacylated precursor peptide, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): GSSFLSPEHQRVQQRKESKKPPAKLQPR, Molecular Weight: 3244.7, Physical State: Powder, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-386
Supplier: Anaspec Inc


Description: AnaTag* HiLyte* Fluor 555 Microscale Protein Labeling Kit *Ultra Convenient* Component: HiLyte Fluor* 555 SE 3 vials, Reaction buffer 0.5 mL, Spin column, DMSO 150 uL, Elution buffer 20 mL, Wash tube 3 tubes, Collect tube 3 tubes
Catalog Number: 103010-352
Supplier: Anaspec Inc


Description: SensoLyte* 490 MMP-1 Assay Kit *Fluorimetric*, Components: MMP-1 substrate 270 ul, EDANS 1 mM, 10 ul, APMA, 4-aminophenylmercuric acetate 1 M, 100 ul, Assay buffer 60 mL, Stop solution 30 mL, with Convenient Format, Enhanced Value, High Speed, storage: -20 deg C
Catalog Number: 103010-150
Supplier: Anaspec Inc


Description: CSP-2, Competence-Stimulating Peptide-2, Sequence: EMRISRIILDFLFLRKK, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 2178.7, Apperance: Off-white solid, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-792
Supplier: Anaspec Inc


Description: Roduct Name Angiotensin I Converting Enzyme 2, (ACE - 2) Substrate, Purity: By HPLC >/= 95%, MW: 696.7, Sequence: (One-Letter Code): Mca-APK(Dnp), Appearance: Lyophilized yellow powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103006-002
Supplier: Anaspec Inc


Description: Cys(Npys)-(D-Arg)9, applicable in conjugation and cell permable studies, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): C(Npys)rrrrrrrrr-NH2, Molecular Weight: 1680.1, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-410
Supplier: Anaspec Inc


Description: SensoLyte* 520 BACE2 Activity Assay *Fluorimetric*, Components: HiLyte Fluor*488/QXLTM -520 BACE2 substrate 1 mM, 50 uL, HiLyte Fluor*488 1 mM, 15 uL, Assay Buffer 30 mL, BACE2 Inhibitor 50 uM, 15 uL, Stop Solution 10 ml, Optimized Performance, Enhanced Value
Catalog Number: 103010-666
Supplier: Anaspec Inc


Description: DiI [[1,1'-Dioctadecyl-3,3,3',3'- tetramethylindocarbocyanine iodide]], Molecular Weight: 961.32, A lipophilic membrane stain that diffuses laterally to stain the entire cell, Storage: -20 deg C, size: 100 mg
Catalog Number: 103010-216
Supplier: Anaspec Inc


Description: 37,43Gap 27, Connexin Mimetic, Sequence: SRPTEKTIFII, Purity: By HPLC greater than or equal to 95%, peptide corresponds to the GAP27 domain of connexin, Molecular Weight: 1304.6, Apperance: powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-450
Supplier: Anaspec Inc


897 - 912 of 2,094