Print…

You Searched For: Anaspec Inc


2,094  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"2094"

Rate These Search Results

Image Unavailable-103010-602

SensoLyte* AMC DPPIV Assay Kit

Description: SensoLyte* AMC DPPIV Assay Kit *Fluorimetric*, Components: DPPIV Substrate 55 uL, AMC 5 mM, 10 uL, DPPIV, porcine kidney 0.1 mg/mL, 15 uL, Assay Buffer 25 mL, DPPIV Inhibitor 10mM, 15 uL, Optimized Performance, Enhanced Value, Assured Reliability, storage: -20 deg C
Catalog Number: 103010-602
Supplier: Anaspec Inc
Image Unavailable-103010-674

Sortase A protease Recombinant 10 ug

Description: Sortase A protease, Recombinant, purity: >87% SDS PAGE, Sortases are a family of membrane–anchored transpeptidases expressed by Gram–positive bacteria, catalyzes the cleavage of C-terminal recognition motif, Storage: -80 deg C, Size: 10 ug
Catalog Number: 103010-674
Supplier: Anaspec Inc
Image Unavailable-102996-762

390 MMP FRET Substrate I 5 mg

Description: 390 MMP FRET Substrate I, Purity: HPLC >/= 95%, Molecular Weight: 1093.2, Sequence: Mca-Pro-Leu-Gly-Leu-Dap(Dnp)-Ala-Arg-NH2, Appearance: Lyophilized yellow powder, A fluorogenic substrate that is best cleaved by MMP-7, 8, 9 and 13, Size: 5 mg
Catalog Number: 102996-762
Supplier: Anaspec Inc
Image Unavailable-103007-734

CK1 Peptide Substrate [pS7] 1 mg

Description: CK1 Peptide Substrate [pS7], Sequence: KRRRAL-pS-VASLPGL, Purity: By HPLC greater than or equal to 95%, peptide sequence is based on rabbit muscle glycogen synthase with Ser7 phosphorylated, Molecular Weight: 1603.9, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-734
Supplier: Anaspec Inc
Image Unavailable-103007-750

gp91 ds-tat, sgp91 ds-tat scrambled 1 mg

Description: gp91 ds-tat, sgp91 ds-tat, scrambled, Sequence: YGRKKRRQRRRCLRITRQSR-NH2, Purity: By HPLC greater than or equal to 95%, This is a control peptide for gp91 ds-tat, Molecular Weight: 2673.2, Apperance: powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-750
Supplier: Anaspec Inc
Image Unavailable-102999-618

Cys - beta - Amyloid (1 - 42) 0.1 mg

Description: Cys - beta - Amyloid (1 - 42), Human, Sequence: CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4617.3, Apperance: Powder, Storage: -20 deg C, Size: 0.1 mg
Catalog Number: 102999-618
Supplier: Anaspec Inc
Image Unavailable-103003-182

Beta-Amyloid (1-40) 0.1 mg

Description: Beta-Amyloid (1-40), Human, Purity: HPLC >/- 95%, Molecular Weight: 5333.2, Sequence: HiLyte* Fluor 647-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, label: HiLyte* Fluor 647, Appearance: Powder, Storage: -20 deg C, Size: 0.1 mg
Catalog Number: 103003-182
Supplier: Anaspec Inc
Image Unavailable-103009-362

[Arg(Me2a)3]-Histone H4

Description: [Arg(Me2a)3]-Histone H4 (1-23)-GGK, Purity: HPLC >/= 95%, MW: 2857.4, Sequence: [SG-R(Me2a)-GKGGKGLGKGGAKRHRKVLRGG-K(Biotin)] asymmetrically dimethylated at Arg3 followed by a biotinylated Lys conjugated to a C-terminal GG linker. Store: -20 deg C, Size: 1mg
Catalog Number: 103009-362
Supplier: Anaspec Inc
Image Unavailable-103007-108

Beta - Amyloid (1 - 40) - Lys(LC - biotin) - NH2 0.1 mg

Description: Beta - Amyloid (1 - 40) - Lys(LC - biotin) - NH2, FAM - labeled, Human, FABB, Purity: By HPLC greater than or equal to 95%, biotinylated on the lysine side chain, Molecular Weight: 5154.9, Storage: -20 deg C, Size: 0.1 mg
Catalog Number: 103007-108
Supplier: Anaspec Inc
Image Unavailable-103011-370

TMRM 25 mg

Description: TMRM, Synonym: Tetramethylrhodamine, methyl ester, perchlorate, Used for measuring membrane potential of mitochondria; Fluorescence is less dependent on dye location, Molecular Weight: 500.9, Spectral Properties: Abs/Em = 549/573 nm, Solvent System DMSO, Storage: -20 deg C, Size: 25mg
Catalog Number: 103011-370
Supplier: Anaspec Inc
Image Unavailable-103000-722

CEF26, Influenza Virus NP (265 - 274) 1 mg

Description: CEF26, Influenza Virus NP (265 - 274), HLA-A*03 restricted epitope from influenza virus nucleoprotein (265-274), Molecular Weight: 980.2, Sequence: ILRGSVAHK, Physical State: Solid, Storage: -20 deg C Store away from oxidizing agent, Size: 1 mg
Catalog Number: 103000-722
Supplier: Anaspec Inc
Image Unavailable-103007-974

[Lys(Me1)9]-Histone H3 (1-21)-GGK(Biotin) H3K9(Me1) 1 mg

Description: [Lys(Me1)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Me1), biotin-labeled, Sequence: ARTKQTAR-K(Me1)-STGGKAPRKQLA-GGK(Biotin), Purity: By HPLC >/= 95%, Residues 1 to 21 mono-methylated at Lys-9, Molecular Weight: 2737.2, Size: 1 mg
Catalog Number: 103007-974
Supplier: Anaspec Inc
Image Unavailable-103010-848

5-TAMRA, SE 5mg

Description: 5-TAMRA, SE, Synonym: 5-Carboxytetramethylrhodamine, succinimidyl ester; 5-TAMRA, NHS ester, for labeling proteins, the single isomers for labeling peptides, nucleotides, Molecular Weight: 527.53, Molecular Formula: C29H25N3O7, Spectral Properties: Abs/Em = 547/574 nm, Size: 5mg
Catalog Number: 103010-848
Supplier: Anaspec Inc
Image Unavailable-103001-340

Anti-PLP (178-191) IgG Quantitative ELISA Kit

Description: SensoLyte* Anti-PLP (178-191) IgG Quantitative ELISA Kit (Mouse) Colorimetric, determine anti-PLP (178-191) IgG antibody, Wells are pre-coated with PLP peptide and pre-blocked with BSA, Storage: At 2-8 degree C, Size: One 96-well strip plate
Catalog Number: 103001-340
Supplier: Anaspec Inc
Image Unavailable-102999-750

Beta - Amyloid (11 - 22) 1 mg

Description: Beta - Amyloid (11 - 22), Human, Sequence: EVHHQKLVFFAE, Purity: HPLC greater than or equal to 95%, Molecular Weight: 1483.7, Apperance: Powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102999-750
Supplier: Anaspec Inc
Image Unavailable-103007-716

Insulin B Chain Peptide (15-23) 1 mg

Description: Insulin B Chain Peptide (15-23), Sequence: LYLVCGERG, Purity: By HPLC greater than or equal to 95%, This is amino acids 15 to 23 fragment of the insulin B chain recognized by islet-associated T cells, Molecular Weight: 1009.2, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-716
Supplier: Anaspec Inc
801 - 816 of 2,094