You Searched For: Anaspec Inc

Description: Beta-Amyloid (1-17)-Cys, Human, Sequence: DAEFRHDSGYEVHHQKLC, Purity: HPLC >/= 95%, amino acids 1 to 17 is a modified fragment of the b-amyloid peptide, with cysteine substituted for valine at position 17, Molecular Weight: 2171.3, Storage: -20 C, Size: 1 mg

Catalog Number: 103007-362

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)14/18/23/27]-Histone H3 (1-30)-GGK(Biotin), Purity: HPLC >/= 95%, Molecular weight: 3802.5, Sequence: [ARTKQTARKSTGG-K(Ac)-APR-K(Ac)-QLAT-K(Ac)-AAR-K(Ac)-SAPGG-K(Biotin)], C-terminal GG linker followed by a biotinylated Lys. Size: 1mg

Catalog Number: 103009-090

Supplier: Anaspec Inc

Sale

Description: Bax BH3 peptide (55 - 74), wild type, Sequence: STKKLSECLKRIGDELDSNM, Purity: By HPLC >/= 95%, 20–amino acid Bax BH3 peptide (Bax 1) capable of inducing apoptosis in a variety of cell line models, Molecular Weight: 2267.6, Storage: -20 C, Size: 1 mg

Catalog Number: 103007-264

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Rh110 Matriptase Activity Assay Kit, Fluorimetric, Contains: Rh110 Matriptase substrate, Rh110 fluorescence reference standard, Matriptase, human recombinant, Assay Buffer, Leupeptin, Storage: -20 degree C, Size: 100 Assays (96-well plate)

Catalog Number: 103008-976

Supplier: Anaspec Inc

Sale

Description: Biotin - ACTH (1 - 39), human, Sequence: Biotin - SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4768.4, Apperance: Powder, application: used in ELISA assays, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102999-762

Supplier: Anaspec Inc

Sale

Description: FITC-LC-Antennapedia Peptide, Purity: HPLC >/= to 95%, Molecular Weight: 2748.3, Sequence: FITC-LC-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-NH2, This is a fluorescent (FITC)-labeled Antennapedia, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-458

Supplier: Anaspec Inc

Sale

Description: 26Rfa, Hypothalamic Peptide, rat, neuropeptide, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): ASGPLGTLAEELSSYSRRKGGFSFRF-NH2, Molecular weight: 2820.2, Physical State: Lyophilized White Powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-890

Supplier: Anaspec Inc

Sale

Description: Peptide YY, human, Purity: HPLC >/= to 95%, Molecular Weight: 4309.8, Sequence: YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, Appearance: Lyophilized white powder, is a 36-amino acid regulatory gut hormone present in endocrine cells in the intestine, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-558

Supplier: Anaspec Inc

Sale

Description: Thrombin Receptor Activator for Peptide 6 (TRAP-6), Purity: HPLC >/= to 95%, Molecular Weight: 748.9, Sequence: H-Ser-Phe-Leu-Leu-Arg-Asn-OH, This peptide forms the N-terminal sequence left after thrombin cleavage, Storage: -20 deg C, Size: 25 mg

Catalog Number: 102996-470

Supplier: Anaspec Inc

Sale

Description: [Lys(Me2)9]-Histone H3 (3-17) H3K9(Me2), Sequence: TKQTAR-K(Me2)-STGGKAPR, Purity: By HPLC greater than or equal to 95%, peptide is Histone H3 amino acid residues 1 to 10 di-methylated at Lys-9, Molecular Weight: 1614.8, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103008-024

Supplier: Anaspec Inc

Sale

Description: 5(6)-TAMRA-X, SE, Synonym: 6-(Tetramethylrhodamine-5-(and-6)-carboxamido) hexanoic acid, succinimidyl ester; 5(6)-TAMRA-X, NHS ester, Molecular Weight: 640.69, Spectral Properties: Abs/Em = 544/572 nm, Solvent System: DMF or DMSO, Storage -20 deg C, Size: 5mg

Catalog Number: 103010-856

Supplier: Anaspec Inc

Sale

Description: P53 (17-26) sequence contains the residues that contact the binding domain of Mdm-2, important in maintaining genome stability and preventing cancer development, Purity: HPLC>/=95%, Sequence (One-Letter Code): ETFSDLWKLL, Molecular weight: 1251.5, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-594

Supplier: Anaspec Inc

Sale

Description: TAT - NSF700scr, Sequence: YGRKKRRQRRRGGGIPPVYFSRLDLNLVVLLLAQL, (TAT) N-ethylmaleimide-sensitive factor (NSF) 700scr peptide is used as a control peptide to TAT-NSF700 peptide, Molecular Weight: 4109.9, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-244

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Anti - MOG(35 - 55) IgG Quantitative ELISA Kit (mouse/rat), Contains: Pre-coated and pre-blocked 96-well strip plate, Standard for calibration, A detailed protocol, Storage: 4degree C, Size: 96 assays

Catalog Number: 102997-814

Supplier: Anaspec Inc

Sale

Description: Substance P, FAM-labeled fluorecent (FAM)-labeled Substance P, Abs/Em = 494/521 nm, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): FAM-RPKPQQFFGLM-NH2, Molecular weight: 1706, Appearance: Lyophilized yellow powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103006-404

Supplier: Anaspec Inc

Sale

Description: 6-FAM, isomer of carboxyfluorescein, Synonym: 6-Carboxyfluorescein, Molecular Weight: 376.32, Molecular Formula: C21H12O7, Appearance: Red solid, Purity: >95 % (TLC), Spectral Properties: Abs/Em = 495/517 nm, Solvent System: DMF or DMSO, Storage: -20 deg C desiccated, Size: 100 mg

Catalog Number: 103010-760

Supplier: Anaspec Inc

Sale