Human ACTH (1-39),Biotin

Supplier: Anaspec Inc

AS-23968
102999-762EA 423.85 USD
102999-762
Human ACTH (1-39),Biotin
Proteins and Peptides

This C-terminally labeled biotin ACTH (1-39) has been used in ELISA assays. This 39 amino acid-peptide hormone is produced in the anterior pituitary gland upon stimulation by the corticotropin releasing hormone from the hypothalamus in response to stress. It stimulates the secretion of steroid hormone, specifically glucocorticoids in the adrenal cortex by acting through a cell membrane receptor (ACTH-R).
Sequence: Biotin - SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
MW: 4768.4 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Order Now


Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR