You Searched For: Anaspec Inc

Description: Suc-LLVY-AMC, fluorogenic substrate, Sequence: Suc-LLVY-AMC, Purity: By HPLC >/= 95%, used as a fluorogenic substrate for 20S proteasome, calpains and other chymotrypsin-like proteases, Molecular Weight: 763.9, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103007-798

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 490 HIV Protease Assay Kit *Fluorimetric*, Components: HIV-1 protease substrate 600 ul, EDANS 100 u
M DMSO solution, 20 ul, Pepstatin A 27.4 u
g powder, 2X Assay buffer 50 mL, Stop solution 30mL, DMSO 100 ul, DMSO 100 ul, storage: -20 deg C

Catalog Number: 103010-148

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (1-40), Purity: HPLC >/- 95%, Molecular Weight: 4742.4, Sequence: TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, label: TAMRA, Appearance: Lyophilized red powder, this is a fluorescent labeled B-Amyloid peptide, Abs/Em=551/567 nm, Size: 0.1 mg

Catalog Number: 103003-174

Supplier: Anaspec Inc

Sale

Description: Beta - Amyloid (1 - 15) - Lys16(HiLyte* Fluor 488), Human, B-Amyloid peptide, residues 1 to 16 labeled with HiLyte* Fluor 488 on the Lys16, Abs/Em =501/527, Molecular Weight: 2311.4, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 103007-136

Supplier: Anaspec Inc

Sale

Description: Vitronectin (367-378), Purity: HPLC >/= 95%, MW: 1668, Sequence: [GKKQRFRHRNRKG] This heparin-binding peptide is derived from vitronectin (367-378). Monomer form in the blood and oligomer form in the extraceullular matrix. Biotin - labeled, Store: -20 deg C, Size: 5mg

Catalog Number: 103009-404

Supplier: Anaspec Inc

Sale

Description: Cathepsin K substrate, Sequence: Abz - HPGGPQ - EDDnp, Purity: By HPLC greater than or equal to 95%, FRET peptide can be used to monitor selectively cathepsin K activity in physiological fluids, Molecular Weight: 920, Storage: -20 deg C, Size: 0.1 mg

Catalog Number: 103007-314

Supplier: Anaspec Inc

Sale

Description: Chlorotoxin (Cltx), Purity: >/= 95%, MW: 3996, Sequence: MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35) A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus, Appearance: Lyophilized white powder, Size: 0.1 mg

Catalog Number: 103005-970

Supplier: Anaspec Inc

Sale

Description: DABCYL acid, Synonym: 4-((4-(dimethylamino)phenyl)azo)benzoic acid, UltraPure Grade, acceptors for developing FRET-based nucleic acid probes and protease substrates, Molecular Weight: 269.3, Spectral Properties: Abs/Em = 425/none nm, Solvent System: DMF or DMSO, Size: 1g

Catalog Number: 103011-046

Supplier: Anaspec Inc

Sale

Description: [Lys(Me2)20]-Histone H4 (8-30)- WGK(Biotin); H4K20(Me2) (8-30), Purity: HPLC >/= 95%, MW: 3170.7, Sequence: [Ac-KGLGKGGAKRHR-K(Me2)-VLRDNIQGITWG-K(biotin)], amino acid residues 8-30 with a C-terminal WG linker, biotin - labeled, Store: -20 deg C, Size: 1mg

Catalog Number: 103009-612

Supplier: Anaspec Inc

Sale

Description: Protease-Activated Receptor-3, PAR-3 Agonist, amide, Sequence: SFNGGP-NH2, Purity: By HPLC >/= 95%, peptide is one of the four PAR sub-types, and is acted upon by thrombin, Molecular Weight: 576.6, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-560

Supplier: Anaspec Inc

Sale

Description: TAT (47-57) GGG-Cys(Npys) protein transduction domain of the TAT protein and is synthesized with an activated cysteine residue C(Npys), Purity: HPLC>/=95%, Sequence (One-Letter Code): YGRKKRRQRRRGGG-C(Npys)-NH2, Molecular weight: 1987.3, Storage: -20degree C, Size: 1mg

Catalog Number: 103006-428

Supplier: Anaspec Inc

Sale

Description: Peptide Substrate for Renin 520 Assay kit, Purity: HPLC greater than or equal to 95%, Molecular Weight: 2000 - 2200, Appearance: Lyophilized red powder, for screening of renin inhibitors, Storage: -20 degree C, Size: 0.1 mg

Catalog Number: 103007-076

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Plus 520 MMP-9 Assay Kit *Fluorimetric*, Components: MMP-9 antibody 12 X 8 black strips, MMP-9 STD 10 u
g/mL, 10 ul, MMP dilution buffer 10 mL, 10 X Wash buffer 50 mL, APMA 100 mM, 150 ul, MMP-1 substrate 50 ul, Assay buffer 50 mL, Stop Solution 10 mL

Catalog Number: 103010-290

Supplier: Anaspec Inc

Sale

Description: Protease-Activated Receptor-1, PAR-1 Agonist, amide, Sequence: TFLLRN-NH2, Purity: By HPLC >/= 95%, proteinase activated receptor (PAR-1) belongs to a subfamily of G-protein coupled receptor, Molecular Weight: 761.9, Size: 5 mg

Catalog Number: 103007-558

Supplier: Anaspec Inc

Sale

Description: AnaTag* HiLyte* Fluor 555 Microscale Protein Labeling Kit *Ultra Convenient* Component: HiLyte Fluor* 555 SE 3 vials, Reaction buffer 0.5 mL, Spin column, DMSO 150 uL, Elution buffer 20 mL, Wash tube 3 tubes, Collect tube 3 tubes

Catalog Number: 103010-352

Supplier: Anaspec Inc

Sale

Description: 520 MMP FRET Substrate XIV, Purity: By HPLC >/= 95%, MW: 1913.1, Sequence: (One-Letter Code): QXL* 520 -Y-Abu-P-Cha-Abu-Smc-HA-Dab(5-FAM)-AK-NH2 (Smc=S-Methyl-L-cysteine)substrate for assaying MMP-1, 2, 3, 7, 8, 9, 12, and 13 activities, Size: 0.1 mg

Catalog Number: 103005-942

Supplier: Anaspec Inc

Sale