You Searched For: Anaspec Inc

Description: Cytomegalovirus (CMV) Control Peptide Pool, peptides have been used in the stimulation of IFNgamma release from CD8+ T cells in individuals with defined HLA types, Storage: -20 deg C, Size: 1.25 mg

Catalog Number: 103007-296

Supplier: Anaspec Inc

Sale

Description: [Leu5]-Enkephalin, Purity: HPLC >/= 95%, Molecular Weight: 555.7, Sequence: H-Tyr-Gly-Gly-Phe-Leu-OH, Appearance: Solid, Storage: -20 deg C, Size: 25 mg

Catalog Number: 102996-548

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 Total GSH Assay Kit *Fluorimetric*, Components: Thiol Detection Reagent 25 ul, Reduced Glutathione Standard Stock Solution 10 mM, 100 ul, GSH Reductase 30 ul, NADPH 15 ul, Assay Buffer 20 mL, 5-Sulfosalicylic Acid (SSA) 1 g, storage: -20 deg C

Catalog Number: 103010-512

Supplier: Anaspec Inc

Sale

Description: 4N1K, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1384.8, Sequence: KRFYVVMWKK; H - Lys - Arg - Phe - Tyr - Val - Val - Met - Trp - Lys - Lys - OH, cell-binding domain adhesive peptide. It has been identified as an IAP agonist, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-256

Supplier: Anaspec Inc

Sale

Description: A1(I) Collagen (614-639), Type I Collagen A1(I) C-Telopeptide, human, Sequence: SAGFDFSFLPQPPQEKAHDGGRYYRA, Purity: HPLC >/= 95%, inhibitor of collagen fibrillar matrix assembly, Molecular Weight: 2942.2, Size: 1 mg

Catalog Number: 103007-766

Supplier: Anaspec Inc

Sale

Description: Neurotensin (8-13), Purity: HPLC >/= 95%, Molecular Weight: 817, Sequence: H-Arg-Arg-Pro-Tyr-Ile-Leu-OH, The intrastriatal perfusion with the neurotensin(1-13) [NT(1-13)] and its active fragment NT(8-13) on striatopallidal GABA, Storage: -20 deg C, Size: 5 mg

Catalog Number: 102996-346

Supplier: Anaspec Inc

Sale

Description: Corticotropin Releasing Factor, CRF, ovine, Sequence: SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA - NH2, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4670.4, Apperance: White Powder, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102999-386

Supplier: Anaspec Inc

Sale

Description: ARP [[N-(Aminooxyacetyl)-N''''-(D- biotinoyl) hydrazine, trifluoroacetic acid salt]], Molecular Weight: 445.4, Appearance: solid, Solvent System: DMSO or DMF, Biotinylating reagent for carbohydrates and nucleic acids, Storage: -20 deg C, Size: 10 mg

Catalog Number: 103003-296

Supplier: Anaspec Inc

Sale

Description: Angiotensin I, human, Purity: HPLC >/= 95%, Molecular Weight: 1296.5, Sequence: H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-OH, Appearance: Lyophilized white powder, This Angiotensin I sequence also corresponds to horse, sheep, pig, and rat Ang I, Storage: -20 deg C, Size: 5 mg

Catalog Number: 102996-060

Supplier: Anaspec Inc

Sale

Description: PKG Substrate [RKRSRAE], Glasstide, Purity: HPLC >/- 95%, Molecular Weight: 902, Sequence: H-Arg-Lys-Arg-Ser-Arg-Ala-Glu-OH, is a selective substrate for protein kinase G with a strong preference for PKG IA (Km = 59 uM) over PKG II (Km = 305 uM), Size: 5 mg

Catalog Number: 103003-094

Supplier: Anaspec Inc

Sale

Description: Anti-BetaGamma (MPS-Phosducin-like protein C terminus), Purity: HPLC >/= 95%, Molecular Weight: 4601.4, Sequence: AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE, Appearance: Lyophilized white powder, This is a membrane-permeable phosphoducin-like anti-BY peptide, Size: 1mg

Catalog Number: 102996-464

Supplier: Anaspec Inc

Sale

Description: [pSer10]-Histone H3 (1-21)-GGK(Biotin); H3pS10, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2802.2, Sequence: ARTKQTARK-pS-TGGKAPRKQLA-GGK(Biotin)-NH2, Label: Biotin, Histone H3 (aa 1-21), Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-106

Supplier: Anaspec Inc

Sale

Description: HiLyte* Fluor 594 acid, SE, Synonym: HiLyte* Fluor 594 acid, NHS ester, an alternative to Alexa Fluor* 594 and DyLight Fluor* 594, Molecular Weight 848.94, Spectral Properties: Abs/Em = 593/616 nm, Solvent System: DMF/DMSO, Storage: -20 deg C, Form: Solid, Size: 5 mg

Catalog Number: 103010-958

Supplier: Anaspec Inc

Sale

Description: CEF11, Epstein - Barr Virus BMLF1 (280 - 288), GLCTLVAML, HLA A2.1-restricted epitope, Sequence (Three-Letter Code) H - Gly - Leu - Cys - Thr - Leu - Val - Ala - Met - Leu - OH, MW: 920.2, Physical State: Solid, Storage: -20degree C, Size: 1mg

Catalog Number: 102997-158

Supplier: Anaspec Inc

Sale

Description: MOG (35-55), mouse, rat, Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 2582, Sequence: MEVGWYRSPFSRVVHLYRNGK (1-letter code), member of the immunoglobulin superfamily and is expressed in central nervous system (1-3), Storage: At -20 Degree C, Size: 1mg

Catalog Number: 103002-980

Supplier: Anaspec Inc

Sale

Description: S2238, Thrombin Substrate, Sequence: f-Pip-R-pNA, Purity: By HPLC greater than or equal to 95%, This is a chromogenic substrate for thrombin, Abs=405 nm, Molecular Weight: 552.6, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-720

Supplier: Anaspec Inc

Sale