Print…

You Searched For: Anaspec Inc


2,094  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"2094"

Rate These Search Results

Image Unavailable-103010-122

SensoLyte* FDP Alkaline Phosphatase Assay Kit

Description: SensoLyte* FDP Alkaline Phosphatase Assay Kit *Fluorimetric*, Components: FDP, 1 vial, 2X Assay buffer 30 mL, Stop solution 30 mL, 10X Lysis buffer 50 mL, Triton X-100 500 ul, 500 ul, Alkaline Phosphatase Standard Calf Intestine 10 u
g/mL, 50 ul
Catalog Number: 103010-122
Supplier: Anaspec Inc
Image Unavailable-103006-882

EA (52-68) 1 mg

Description: EA (52-68), class II MHC EA chain (EA) (52-68) peptide (AbBEp). It occupies about 10% of natural Iab, Purity: HPLC >/=95%, Sequence (One-Letter Code): ASFEAQGALANIAVDKA, Molecular weight: 1675.9, Physical State: Lyophilized White Powder, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-882
Supplier: Anaspec Inc
Image Unavailable-103003-042

Beta-Amyloid (1-37) 1mg

Description: Beta-Amyloid (1-37), Human, Purity: Greater than or equal to 95% (% Peak Area By HPLC), Molecular weight: 4074.6, Sequence: (One-Letter Code) AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG, Storage: At -20 degree C, Size: 1mg
Catalog Number: 103003-042
Supplier: Anaspec Inc
Image Unavailable-103011-014

Sulforhodamine 101 C2 maleimide 5 mg

Description: Sulforhodamine 101 C2 maleimide, thiol-reactive reagent for protein modification as amino acid, peptides and protein, MW: 728.84, Spectral: Abs/Em = 588/601 nm, Solvent System: DMF or DMSO, Storage: -20 deg C Store away from oxidizing agent, Size: 5 mg
Catalog Number: 103011-014
Supplier: Anaspec Inc
Image Unavailable-103006-504

Human Beta-Amyloid (1-40)-Lys(Biotin)-NH₂, Biotin, AnaSpec

Description: Human Beta-Amyloid (1-40)-Lys(Biotin)-NH₂, Biotin, AnaSpec
Catalog Number: 103006-504
Supplier: Anaspec Inc
Image Unavailable-103006-346

GRGDS, Amide

Description: GRGDS, Amide
Catalog Number: 103006-346
Supplier: Anaspec Inc
Image Unavailable-103006-356

C3a (70-77)

Description: C3a (70-77)
Catalog Number: 103006-356
Supplier: Anaspec Inc
Image Unavailable-103008-426

Vaccinia Virus B8R (20-27)

Description: Vaccinia Virus B8R (20-27)
Catalog Number: 103008-426
Supplier: Anaspec Inc
Image Unavailable-103008-438

Chicken OVA (323-339), FITC (Fluorescein Isothiocyanate)

Description: Chicken OVA (323-339), FITC (Fluorescein Isothiocyanate)
Catalog Number: 103008-438
Supplier: Anaspec Inc
Image Unavailable-103008-422

Mouse;Rat Kisspeptin-10 (Kp-10)

Description: Mouse;Rat Kisspeptin-10 (Kp-10)
Catalog Number: 103008-422
Supplier: Anaspec Inc
Image Unavailable-102996-116

Human Glucagon-Like Peptide 1, GLP-1 (7-37)

Description: Human Glucagon-Like Peptide 1, GLP-1 (7-37)
Catalog Number: 102996-116
Supplier: Anaspec Inc
Image Unavailable-102996-114

Human Glucagon-Like Peptide 1, GLP-1 (7-37)

Description: Human Glucagon-Like Peptide 1, GLP-1 (7-37)
Catalog Number: 102996-114
Supplier: Anaspec Inc
Image Unavailable-103003-040

Human Beta-Amyloid (1-37)

Description: Human Beta-Amyloid (1-37)
Catalog Number: 103003-040
Supplier: Anaspec Inc
Image Unavailable-102998-098

Human Recombinant MOG (1-125) (from E. coli)

Description: Human Recombinant MOG (1-125) (from <i>E. coli</i>)
Catalog Number: 102998-098
Supplier: Anaspec Inc
Image Unavailable-102998-100

Human Recombinant MOG (1-125) (from E. coli)

Description: Human Recombinant MOG (1-125) (from <i>E. coli</i>)
Catalog Number: 102998-100
Supplier: Anaspec Inc
Image Unavailable-103002-946

Cyclin-dependent kinase 5 peptide

Description: Cyclin-dependent kinase 5 peptide
Catalog Number: 103002-946
Supplier: Anaspec Inc
225 - 240 of 2,094