You Searched For: Anaspec Inc

Description: [Asn7]-beta-Amyloid (1-42), Tottori-Japanese Mutation, Sequence: DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Purity: By HPLC >/= 95%, Asp7 is replaced by Asn7, Molecular Weight: 4513.1, Apperance: Powder, Size: 0.5 mg

Catalog Number: 103007-608

Supplier: Anaspec Inc

Sale

Description: HiLyte* Fluor 488 amine, TFA Salt, carbonyl-reactive fluorescent labeling dye, independent of pH from 4 to 10, Molecular Weight: 530.45, Spectral Properties: Abs/Em = 503/528 nm, Solvent System: DMF or DMSO, Physical State: Solid, Storage: -20 deg C, Size: 1mg

Catalog Number: 103010-878

Supplier: Anaspec Inc

Sale

Description: HiLyte* Fluor 647 C2 maleimide, thiol-reactive fluorescent labeling dye, Molecular Weight: 1196.46, Spectral Properties: Abs/Em = 649/674 nm, Solvent System: water or DMF, used to generate protein conjugates, Physical State: Solid, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103010-798

Supplier: Anaspec Inc

Sale

Description: Neutrophil elastase Substrate, AFC (Antibody-fluorophore conjugate)

Catalog Number: 102996-448

Supplier: Anaspec Inc

Sale

Description: 390 MMP FRET Substrate V, Sequence: Mca - PLGLEEA - Dpa - NH2, Purity: By HPLC greater than or equal to 95%, a substrate for the MMP-12, macrophage elastase, Abs/Em = 325/393 nm, Molecular Weight: 1193.2, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-144

Supplier: Anaspec Inc

Sale

Description: DACM, Synonym: N-(7-Dimethylamino-4-methylcoumarin-3-yl)maleimide, blue fluorescent thiol-reactive reagent that is widely used for probing configurations of biomolecules such as proteins, MW: 298.3, Spectral Properties: Abs/Em = 383/463 nm, Solvent System: DMSO, Size: 10 mg

Catalog Number: 103010-978

Supplier: Anaspec Inc

Sale

Description: Beta - Amyloid (10 - 20), Human, Sequence: YEVHHQKLVFF, Purity: HPLC greater than or equal to 95%, A number of AB fragments including AB (10-20) enhances aggregation of AB (1-40), Molecular Weight: 1446.7, Apperance: Powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102999-858

Supplier: Anaspec Inc

Sale

Description: V5 Epitope Tag sequence is from the C-terminal sequence of the P and V proteins of Simian Virus 5, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): GKPIPNPLLGLDST, Molecular Weight: 1421.7, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-384

Supplier: Anaspec Inc

Sale

Description: GALA, Pore - Forming Peptide, Sequence: WEAALAEALAEALAEHLAEALAEALEALAA, Purity: By HPLC greater than or equal to 95%, synthetic peptide with a glutamic acid-alanine-leucine-alanine (EALA) repeat, Molecular Weight: 3032.4, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-280

Supplier: Anaspec Inc

Sale

Description: ClearPoint* Angiotensin I, 13C and 15N labeled, human, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1309.5, Sequence: DR-V*-Y-I*-HPFHL [Val* -Val(U-13C5,15N); Ile* -Ile(U-13C6,15N)], with valine and isoleucine, Storage: -20 degree C, Size: 0.1mg

Catalog Number: 103009-014

Supplier: Anaspec Inc

Sale

Description: FITC (fluorescein-5-isothiocyanate, fluorescein isothiocyanate isomer I)

Catalog Number: 102998-068

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Anti-Human MOG (1-125) Human IgG Specific ELISA Kit, Optimized to detect anti-human MOG (1-125) IgG in human samples, Wells are pre-coated with recombinant human MOG, Storage: At 2-8 degree C, Size: One 96-well strip plate

Catalog Number: 103001-242

Supplier: Anaspec Inc

Sale

Description: Elastin, FITC Conjugated, soluble bovine neck ligament elastin, heavily labeled with FITC, conjugate's fluorescence is quenched, Spectral property : Abs/Em = 492/515 nm, Solvent System: Water, Fluorescence: Excitation/Emission wavelength= 490 nm/520 nm, Size: 1 mg

Catalog Number: 103011-296

Supplier: Anaspec Inc

Sale

Description: NFF-3, Mca-DNP

Catalog Number: 102996-800

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (42-1), Human, Sequence: AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD, Purity: Peak Area By HPLC greater than or equal to 95%, Molecular Weight: 4514.1, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 0.1 mg

Catalog Number: 103000-624

Supplier: Anaspec Inc

Sale

Description: HiLyte™ Fluor 647 acid fluorescent dye

Catalog Number: 103010-190

Supplier: Anaspec Inc

Sale