You Searched For: Anaspec Inc

Description: [Lys(Me1)9]-Histone H3 (1-21), Purity: HPLC >/= 95%, MW: 2623.1, Sequence: [ARTKQTAR-K(Me1)-STGGKAPRKQLA-K(Biotin)] This is histone H3 (1-21) monomethylated at Lys9 followed by a biotinylated Lys at its C-terminus. Biotin - labeled, Store: -20 deg C, Size: 1mg

Catalog Number: 103009-902

Supplier: Anaspec Inc

Sale

Description: 5(6)-TAMRA cadaverine, Synonym: Tetramethylrhodamine 5-(and-6)-carboxamide cadaverine, reagent for modifying carboxy groups via EDC-mediated reactions, Molecular Weight: 514.62, Spectral Properties: Abs/Em = 544/570 nm, Solvent System DMF or DMSO, Size: 10 mg

Catalog Number: 103011-028

Supplier: Anaspec Inc

Sale

Description: Histone H3 (1-21), FAM labeled, Sequence: ARTKQTARKSTGGKAPRKQLAGG-K(FAM)-NH2, Purity: By HPLC >/= 95%, sequence corresponds to the first 21 amino acids of the NH2 terminal of histone H3, Molecular Weight: 2854.2, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-756

Supplier: Anaspec Inc

Sale

Description: SensoLyte* FDP Protein Phosphatase Assay Kit *Fluorimetric*, Components: FDP 1 vial, Assay buffer, pH 6.5 60 ml, 10X Lysis buffer 50 ml, Triton X-100 500 uL, Stop solution 30 ml, 1 M DTT 100 ul, DMSO 500 ul, storage: -20 deg C

Catalog Number: 103010-108

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 Enterokinase Activity Assay Kit *Fluorimetric*, Components: 5-FAM/QXL*-520 Factor Xa substrate 2 mM, 50 uL, 5-FAM 2 mM, 10 uL, Recombinant Bovine Enterokinase 40 uL, 2X Assay Buffer 25 mL, Inhibitor E-64 50 mM, 20 uL, storage: -20 deg C

Catalog Number: 103010-626

Supplier: Anaspec Inc

Sale

Description: [Lys(Me1)36]-Histone H3 (21-44)-GK(Biotin), H3K36(Me1), biotin-labeled, Sequence: ATKAARKSAPATGGV-K(Me1)-KPHRYRPG-GK(Biotin), Purity: By HPLC greater than or equal to 95%, Molecular Weight: 2931.5, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103008-014

Supplier: Anaspec Inc

Sale

Description: [Arg(Me2a)3]-Histone H4(1-21)-GGK(Biotin), H4R3(Me2a), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2630.14, Sequence: Ac-SG-R(Me2a)-GKGGKGLGKGGAKRHRKVGG-K(Biotin), Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-632

Supplier: Anaspec Inc

Sale

Description: Scrambled - beta - Amyloid (1 - 40), human, Sequence: AEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4329.9, Apperance: Lyophilized white powder, freely soluble in basic buffer, Size: 0.5 mg

Catalog Number: 102999-804

Supplier: Anaspec Inc

Sale

Description: Indolicidin (ILPWKWPWWPWRR - NH2), Purity: HPLC greater than or equal to 95%, Sequence (Three-Letter Code): H - Ile - Leu - Pro - Trp - Lys - Trp - Pro - Trp - Trp - Pro - Trp - Arg - Arg - NH2, Molecular Weight: 1906.3, Physical State: Solid, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-238

Supplier: Anaspec Inc

Sale

Description: Human Beta-Amyloid (1-33)

Catalog Number: 103003-038

Supplier: Anaspec Inc

Sale

Description: Drosophila Antennapedia Peptide, FITC (Fluorescein Isothiocyanate)

Catalog Number: 102996-460

Supplier: Anaspec Inc

Sale

Description: Tau Peptide (275-305) (Repeat 2 Domain)

Catalog Number: 103009-738

Supplier: Anaspec Inc

Sale

Description: Human PLP

Catalog Number: 103007-500

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 Mouse Renin Assay Kit *Fluorimetric*, Components: Mouse renin substrate 50 ul, 5-FAM 100 u
M, 10 ul, Mouse Prorenin 0.5 mg/mL, 20 ul, Assay buffer 25 mL, Trypsin Activation buffer 300 ul, Trypsin Inhibitor 10 mM, 20 ul, Renin Inhibitor 1 mM,10 ul

Catalog Number: 103010-526

Supplier: Anaspec Inc

Sale

Description: 5-FITC cadaverine

Catalog Number: 103011-024

Supplier: Anaspec Inc

Sale

Description: Human [Pyr11]-beta-Amyloid (11-40)

Catalog Number: 102997-262

Supplier: Anaspec Inc

Sale