You Searched For: Anaspec Inc

Description: Colivelin, Synthesized to potentiate the neuroprotective effect of humanin (HN), Colivelin completely suppresses cell death induced by overexpressed Familial Alzheimer's disease, Sequence: SALLRSIPAPAGASRLLLLTGEIDLP, Purity: By HPLC >/= 95%, Molecular Weight: 2645.1, Size: 1 mg

Catalog Number: 103007-098

Supplier: Anaspec Inc

Sale

Description: Bak BH3, high-affinity binding to a surface pocket of the Bcl-XL protein that is essential for its death antagonist function, Purity: HPLC >/=95%, Sequence (One-Letter Code): GQVGRQLAIIGDDINR, MW: 1724.9, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-878

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (1-55), Human, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKK, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 5982.1, Apperance: Lyophilized white powder, Storage: -20 deg C, Size: 0.1 mg

Catalog Number: 103007-612

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 490 MMP-13 Assay Kit *Fluorimetric*, Components: MMP-9 substrate 270 ul, EDANS 1 mM DMSO solution, 10 ul, APMA 1 M, 100 ul, Assay buffer 60 mL, Stop solution 30 mL, with Convenient Format, Optimized Performance, Enhanced Value, High Speed

Catalog Number: 103010-162

Supplier: Anaspec Inc

Sale

Description: Tetramethylrhodamine-5 C2 maleimide

Catalog Number: 103011-006

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)56]-Histone H3 (44-63)

Catalog Number: 103009-034

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 390 ACE2 Activity Assay Kit, Fluorimetric, Contains: Mca/Dnp, ACE2 substrate 5mM, Mca fluorescence reference standard 1mM, Assay Buffer 20mL, Inhibitor of ACE2 100uM, Stop Solution 10mL, Storage: -20 deg C, Size: 100 Assay(96-well plate)

Catalog Number: 103008-964

Supplier: Anaspec Inc

Sale

Description: EGF Receptor Substrate 2 [DADE-pY-LIPQQG]

Catalog Number: 103004-434

Supplier: Anaspec Inc

Sale

Description: [Lys(Me2)27]-Histone H3 (21-44)-GK(Biotin),Biotin

Catalog Number: 103008-006

Supplier: Anaspec Inc

Sale

Description: Influenza A NP(366-374) Strain A/PR/8/35

Catalog Number: 103003-278

Supplier: Anaspec Inc

Sale

Description: 5(6)-TAMRA Special Formulation

Catalog Number: 103010-830

Supplier: Anaspec Inc

Sale

Description: NBD-X 95 HPLC_ASSAY_METHOD

Catalog Number: 103010-902

Supplier: Anaspec Inc

Sale

Description: Bid BH3-r8, pro-apoptotic member of the 'BH3-only' (BOPS) subset of the BCL-2 family of proteins that constitute a critical control point in apoptosis, Purity: HPLC >/= 95%, Sequence (One-Letter Code): rrrrrrrr-GEDIIRNIARHLAQVGDSMDR, MW: 3616.2, Storage: -20degree C, Size: 0.5 mg

Catalog Number: 103006-928

Supplier: Anaspec Inc

Sale

Description: 7-Hydroxycoumarin-3-carboxylic acid, blue fluorophores for labeling proteins and nucleic acids, through, in situ formation of succinimidyl ester, MW: 206.15, Spectral Properties: Abs/Em = 387/448 nm, Solvent System: DMF or DMSO, Size: 250 mg

Catalog Number: 103010-890

Supplier: Anaspec Inc

Sale

Description: HA peptide, Purity: % Peak Area By HPLC >/=95%, belongs to the influenza hemagglutinin (HA) family, Molecular Weight 1102.2, Sequence(One-Letter Code) YPYDVPDYA, Storage -20 deg C, shipped at ambient temperature, Appearance: Lyophilized white powder, freely soluble in H2O, Size: 1mg

Catalog Number: 102998-832

Supplier: Anaspec Inc

Sale

Description: Cys-LC-LL-37, Sequence: C-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES, Purity: By HPLC greater than or equal to 95%, Molecular Weight: 4709.7, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-672

Supplier: Anaspec Inc

Sale