Anaspec Inc

Histone H4 (8-25)-WC 1mg

Description: Histone H4 (8-25)-WC, amide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2278.7, Sequence: KGLGKGGAKRHRKVLRDNWC-NH2, amidated version of Histone H4 residues 8-25. It contains two additional residues (WC) on its C-terminus, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-684

Supplier: Anaspec Inc

Sale

Limited time offers

SensoLyte* AFC Thrombin Activity Assay Kit

Description: SensoLyte* AFC Thrombin Activity Assay Kit *Fluorimetric*, Components: AFC Thrombin substrate 5 mM, 50 uL, AFC 5 mM, 10 uL, 2X Assay buffer 20 mL, Purified human thrombin enzyme 0.01 mg/mL, 40 uL, Thrombin inhibitor 10 mM, 10 uL, Stop solution 5 mL

Catalog Number: 103010-468

Supplier: Anaspec Inc

Sale

Limited time offers

IgG Quantitative ELISA Kit

Description: SensoLyte* Anti - Rat MOG (1 - 125) IgG Quantitative ELISA Kit, Storage 4 deg C, pre-coated with recombinant human MOG (1-125) protein and pre-blocked with BSA, to detect anti-human MOG (1-125) IgG in mouse serum or cerebrospinal fluid, Size: One 96-well strip plate

Catalog Number: 102998-094

Supplier: Anaspec Inc

Sale

Limited time offers

TP53 Q9NP68, p53 Mutant Form (372 - 389), Lys382 (Ac) 1 mg

Description: TP53 Q9NP68, p53 Mutant Form (372 - 389), Lys382 (Ac), Sequence: KKGQSTSRHK - K(Ac) - LMFKTEG, Molecular Weight: 2133.5, freely soluble in water, Apperance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-198

Supplier: Anaspec Inc

Sale

Limited time offers

Secretoneurin 1 mg

Description: Secretoneurin, Sequence: TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ, Purity: By HPLC greater than or equal to 95%, This peptide is amino acids 154 to 186 fragment of secretogranin II, designated secretoneurin, Molecular Weight: 3652, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-474

Supplier: Anaspec Inc

Sale

Limited time offers

Beta-Amyloid (1-16)Human 1 mg

Description: Beta-Amyloid (1-16), Human, Purity: HPLC >/- 95%, Molecular Weight: 1955, Sequence: H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-OH, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103003-702

Supplier: Anaspec Inc

Sale

Limited time offers

TAT (47 - 57) 1 mg

Description: TAT (47 - 57), Purity: By HPLC >/= 95%, MW: 1559.9, Sequence: (One-Letter Code): YGRKKRRQRRR, Sequence(Three-Letter Code): H - Tyr - Gly - Arg - Lys - Lys - Arg - Arg - Gln - Arg - Arg - Arg - OH, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103005-824

Supplier: Anaspec Inc

Sale

Limited time offers

SensoLyte* 490 MMP-8 Assay Kit

Description: SensoLyte* 490 MMP-8 Assay Kit * Fluorimetric*, Components: MMP-8 substrate 270 ul, EDANS 1 mM, 10 ul, APMA 1 M, 100 ul, Assay buffer 60 mL, Stop solution 30 mL, with Convenient Format, Optimized Performance, Enhanced Value, High Speed, storage: -20 deg C

Catalog Number: 103010-158

Supplier: Anaspec Inc

Sale