You Searched For: Anaspec Inc

Description: Influenza NP (147 - 155) (TYQRTRALV), Sequence (Three-Letter Code): H - Thr - Tyr - Gln - Arg - Thr - Arg - Ala - Leu - Val - OH, Molecular Weight: 1107.3, Physical State: Powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-280

Supplier: Anaspec Inc

Sale

Description: TfR Targeting Peptide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1490.8, Sequence: THRPPMWSPVWP, 12-mer peptide sequence is a transferrin receptor (TfR) targeting peptide (transportation of small molecules across the bl), Storage: -20 deg C, Size: 1mg

Catalog Number: 103008-428

Supplier: Anaspec Inc

Sale

Description: Histone H2A (1-20)-GGK(Biotin), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2556, Sequence: SGRGKQGGKARAKAKTRSSRGG-K(Biotin), Label: Biotin, Histone H2A (1-20) with a C-terminal GG linker, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-484

Supplier: Anaspec Inc

Sale

Description: Calcein, AM *UltraPure Grade*, 5 mM solution in anhydrous DMSO, CAS no: 148504-34-1, Purity: >/= 95% HPLC, cell-permeant and non-fluorescent compound that is widely used for determining cell viability, Molecular Weight: 994.9, Spectral Properties: Abs/Em = 494/517 nm, Size: 200ul

Catalog Number: 103011-400

Supplier: Anaspec Inc

Sale

Description: PACAP (1-38), amide, human, ovine, rat, Purity: HPLC >/= to 95%, Molecular Weight: 4534.3, Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2, Appearance: Lyophilized white powder, isolated from bovine hypothalmus, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-264

Supplier: Anaspec Inc

Sale

Description: Biotin - LC - Angiotensin II, Purity: By HPLC >/= 95%, MW: 1385.7, Sequence: (One-Letter Code): Biotin-LC-DRVYIHPFbiotinylated on the N-terminus via an LC (long chain, also known as 6-Aminohexanoyl, 6-Aminocaproyl or Ahx), Size: 5 mg

Catalog Number: 103005-908

Supplier: Anaspec Inc

Sale

Description: STAL-2, Purity: HPLC >/- 95%, Molecular Weight: 747.9, Sequence: H-Ser-Phe-Leu-Leu-Arg-Asn-NH2, Appearance: Powder, This hexapeptide, referred to as STAL-2 or TRAP, is a protease-activated receptor (PAR-1) agonist peptide, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103003-344

Supplier: Anaspec Inc

Sale

Description: Beta - Amyloid (1 - 40) - Lys(LC - biotin) - NH2, FAM - labeled, Human, FABB, Purity: By HPLC greater than or equal to 95%, biotinylated on the lysine side chain, Molecular Weight: 5154.9, Storage: -20 deg C, Size: 0.1 mg

Catalog Number: 103007-108

Supplier: Anaspec Inc

Sale

Description: TMRM, Synonym: Tetramethylrhodamine, methyl ester, perchlorate, Used for measuring membrane potential of mitochondria; Fluorescence is less dependent on dye location, Molecular Weight: 500.9, Spectral Properties: Abs/Em = 549/573 nm, Solvent System DMSO, Storage: -20 deg C, Size: 25mg

Catalog Number: 103011-370

Supplier: Anaspec Inc

Sale

Description: Cys - beta - Amyloid (1 - 42), Human, Sequence: CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4617.3, Apperance: Powder, Storage: -20 deg C, Size: 0.1 mg

Catalog Number: 102999-618

Supplier: Anaspec Inc

Sale

Description: CEF26, Influenza Virus NP (265 - 274), HLA-A*03 restricted epitope from influenza virus nucleoprotein (265-274), Molecular Weight: 980.2, Sequence: ILRGSVAHK, Physical State: Solid, Storage: -20 deg C Store away from oxidizing agent, Size: 1 mg

Catalog Number: 103000-722

Supplier: Anaspec Inc

Sale

Description: [Lys(Me1)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Me1), biotin-labeled, Sequence: ARTKQTAR-K(Me1)-STGGKAPRKQLA-GGK(Biotin), Purity: By HPLC >/= 95%, Residues 1 to 21 mono-methylated at Lys-9, Molecular Weight: 2737.2, Size: 1 mg

Catalog Number: 103007-974

Supplier: Anaspec Inc

Sale

Description: Omega - Conotoxin GVIA, Sequence: CKS(Hyp)GSSCS(Hyp)TSYNCCRSCN(Hyp)YTKRCY - NH2, Purity: HPLC greater than or equal to 95%, neurotoxin that blocks N-type calcium channels, Molecular Weight: 3037.4, Apperance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102999-382

Supplier: Anaspec Inc

Sale

Description: Pancreatic Polypeptide, human, Purity: HPLC >/= to 95%, Molecular Weight: 4181.8, Sequence: APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2, is a 36-amino acid anorexigenic peptide hormone secreted by the PP cells of pancreas, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-312

Supplier: Anaspec Inc

Sale

Description: AnaTag* Biotin Microscale Protein Labeling Kit, Biotin, SE 3 vials, Reaction buffer 0.5 mL, Spin column 3 Pre-packed columns, DMSO 150 uL, Elution buffer 20 mL, Wash tube/Collect tube: 3 Tubes, One conjugation reaction can label up to 200 ug protein

Catalog Number: 103010-372

Supplier: Anaspec Inc

Sale

Description: OVA (257-264), amide, Sequence: SIINFEKL-NH2, Purity: By HPLC >/= 95%, octameric peptide is amino acids 257 to 264 amidated fragment of ovalbumin (OVA), a class I (Kb)-restricted peptide epitope of OVA, Molecular Weight: 962.2, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103007-400

Supplier: Anaspec Inc

Sale