You Searched For: Anaspec Inc

Description: Human Amylin,Biotin

Catalog Number: 103008-174

Supplier: Anaspec Inc

Sale

Description: Human Exendin (9-39)

Catalog Number: 103003-732

Supplier: Anaspec Inc

Sale

Description: Human Exendin (9-39)

Catalog Number: 103003-734

Supplier: Anaspec Inc

Sale

Description: MBP MAPK Substrate

Catalog Number: 102996-874

Supplier: Anaspec Inc

Sale

Description: N-(Biotinoyl)-N''-(iodoacetyl)ethylenediamine

Catalog Number: 103003-294

Supplier: Anaspec Inc

Sale

Description: 390 MMP FRET Substrate II, Purity: HPLC >/= 95%, Molecular Weight: 1094.2, Sequence: Mca-Pro-Leu-Gly-Leu-Dap(Dnp)-Ala-Arg-OH, Appearance: Solid, A generic fluorogenic substrate for assaying MMPs. Abs/Em = 325/393 nm, Size: 5 mg

Catalog Number: 102996-764

Supplier: Anaspec Inc

Sale

Description: [Pyr3] - beta - Amyloid (3 - 40), Human, Purity: HPLC >/= 95%, Sequence (One-Letter Code) Pyr-FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, MW: 4125.7, triggers formation of insoluble AB peptide deposits, inhibit secretion of APP, Storage: -20deg C, Size: 1mg

Catalog Number: 102997-270

Supplier: Anaspec Inc

Sale

Description: 7 - AAD, Synonym: 7 - Aminoactinomycin D, Selectively binding to GC sequence, MW: 1270.5, Spectral Properties: Abs/Em = 546/647 nm, Solvent System: DMSO, Physical State: Solid, CAS number: 7240-37-1, MF: C62H87N13O16, Storage: -20 deg C, Store away from oxidizing agent,

Catalog Number: 103011-122

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (1-40), Purity: HPLC >/- 95%, Molecular Weight: 4686.3, Sequence: HiLyte* Fluor 488-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV, label: HiLyte* Fluor 488, Appearance: Lyophilized orange powder, this is a fluorescent labeled B-Amyloid peptide, Size: 0.1 mg

Catalog Number: 103003-178

Supplier: Anaspec Inc

Sale

Description: Fura-2; AM, UltraPure Grade, Small Package, CAS number: 108964-32-5, Excitation-ratiometric fluorescent indicator for quantifying intracellular Ca2+ concentration, Purity: >/= 95% by HPLC, MW: 1001.9, Spectral: Abs/Em = 363/512 nm, Solvent System: DMSO, Size 50 ug x 20

Catalog Number: 103011-176

Supplier: Anaspec Inc

Sale

Description: OVA-G4 Peptide, OVA (257-264) Variant, Sequence: SIIGFEKL, Purity: By HPLC >/= 95%, G4 peptide (SIIGFEKL) is a variant of the agonist ovalbumin (OVA) peptide (257-264), SIINFEKL, Molecular Weight: 906.1, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103008-044

Supplier: Anaspec Inc

Sale

Description: Glucagon-Like Peptide 1, GLP-1 (7-36)-Lys(Biotin), amide, human, Purity: HPLC >/= to 95%, Molecular Weight: 3551.8, Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2solid, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-408

Supplier: Anaspec Inc

Sale

Description: HiLyte*Fluor 647 acid, SE, Purity >/=95% HPLC, Molecular Weight: 1302.71, Solvent System: DMF or DMSO, is an excellent fluorescent labeling dye that generates the protein conjugates that are slightly red-shifted compared to those of Cy5 dye, Size: 1 mg

Catalog Number: 103010-192

Supplier: Anaspec Inc

Sale

Description: [Lys(Me1)9]-Histone H3 (1-21)-GGK(Biotin); H3K9(Me1), amide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2736.2, Sequence: ARTKQTAR-K(Me1)-STGGKAPRKQLA-GGK(Biotin)-NH2, Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-346

Supplier: Anaspec Inc

Sale

Description: [Arg(Me1)17]-Histone H3 (1-21)-GGK(Biotin), H3R17(Me1), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2736.2, Sequence: ARTKQTARKSTGGKAP-R(Me1)-KQLA-GGK(Biotin)-NH2, Label: Biotin, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-370

Supplier: Anaspec Inc

Sale

Description: 5(6)-CR110, Synonym: 5-(and-6)-Carboxyrhodamine 110, hydrochloride, used to prepare green fluorescent bioconjugate, low photostability and pH-dependent fluorescence, Molecular Weight: 410.81, Spectral Properties: Abs/Em = 498/521 nm, Solvent System: DMF/DMSO, Size: 25 mg

Catalog Number: 103010-860

Supplier: Anaspec Inc

Sale