You Searched For: Anaspec Inc

Supplier: Anaspec Inc

Description: HiLyte™ Fluor 488 acid, SE is an excellent amine-reactive fluorescent labeling dye that generates the protein conjugates far superior to those of fluorescein derivatives such as FITC.

Catalog Number: (103011-290)

Supplier: Anaspec Inc

Description: Besides water-soluble elastin conjugate (85113), AnaSpec also offers water-insoluble fluoresceinated elastin. This water-insoluble conjugate can also be used for fluorometric measurement of elastase activity. Product 85103 is insoluble bovine neck ligament elastin that is heavily labeled with FITC such that the conjugate's fluorescence is quenched. Upon digestion by elastase or other proteases, the fluorescence is recovered. Digestion products from the elastin substrate have absorption maxima at ~492 nm and fluorescence emission maxima at ~515 nm. This insoluble elastin derivative is more specific for elastase than 85113.

Catalog Number: (103011-276)

Supplier: Anaspec Inc

Description: DiSC3(5), Synonym: 3,3'-Dipropylthiadicarbocyanine iodide, Accumulate in cells on hyperpolarized membranes, Molecular Weight: 546.5, Spectral Properties: Abs/Em = 651/675 nm, Solvent System: DMSO, CAS number: 53213-94-8, Molecular formula: C25H27IN2S2, Storage -20C, Size: 100 mg

Catalog Number: (103006-988)

Supplier: Anaspec Inc

Description: Cathepsins are a class of globular lysosomal proteases, playing a vital role in mammalian cellular turnover. They degrade polypeptides and are distinguished by their substrate specificities. Cathepsin D is the lysosomal aspartic proteinase, active in intracellular protein breakdown. Cathepsin D is involved in the pathogenesis of several diseases such as breast cancer and Alzheimer disease. Cathepsin E is a non-lysosomal aspartic proteinase of the pepsin superfamily. It plays an important role in the protein degradation, the generation of bioactive proteins, and antigen processing. Recent studies have particularly suggested that Cathepsin E is important in host defense against cancer cells and invading microorganisms.
An internally quenched fluorogenic substrate (Ab/Em =328/393 nm) for cathepsins D and E and not for B, H or L, obtained from the hepatopancreas (liver) of the Japanese common squid (Todarodes pacificus). The cleavage occurs at the Phe-Phe amide bond resulting in enhanced fluorescence and is used in screening cathepsin D and E inhibitors and for determining cathepsin D and E activity in tissue cell extracts.
Sequence:Mca-GKPILFFRLK(Dnp)-r-NH2
MW:1756.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103006-968)

Supplier: Anaspec Inc

Description: Histone H1-derived peptide, phosphorylated by protein kinase A, is a substrate for CDK2 and CDK5 (cyclin dependent kinase 5) and PKA.
Sequence:GGGPATPKKAKKL
MW:1252.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103010-880)

Supplier: Anaspec Inc

Description: HiLyte™ Fluor 488 hydrazide is a carbonyl-reactive fluorescent labeling dye.

Catalog Number: (103010-900)

Supplier: Anaspec Inc

Description: DEAC, SE is an excellent blue fluorescent building block for labeling amine-containing biomolecules.

Catalog Number: (103008-442)

Supplier: Anaspec Inc

Description: This is amino acids 2460 to 2495 fragment of cardiac ryanodine receptor (RyR2). RyR2 controls calcium release from the sarcoplasmic reticulum, which begins muscle contraction. Mutated RyR2 is associated to ventricular tachycardia (VT) and sudden death
Sequence:GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP
MW:4103.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: (103008-426)

Supplier: Anaspec Inc

Description: This is amino acids 20 to 27 fragment of B8R, a vaccinia virus (VV) gene that encodes a secreted protein related to gamma interferon receptor (IFN-g). B8R binding to IFN-g neutralizes its antiviral activity.
Sequence:TSYKFESV
MW:960.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-438)

Supplier: Anaspec Inc

Description: This fluorescent (FITC)-labeled OVA (323 - 339) Peptide is an H-2b-restricted OVA class II epitope (Abs/Em = 493/522 nm).
Sequence: FITC-LC-ISQAVHAAHAEINEAGR
MW: 2276.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: (103008-422)

Supplier: Anaspec Inc

Description: Kisspeptin was originally identified as a human metastasis suppressor gene that has the ability to suppress melanoma and breast cancer metastasis. Kisspeptin-GPR54 signaling has an important role in initiating secretion of gonadotropin-releasing hormone (GnRH) at puberty from the anterior pituitary.
This amidated peptide sequence is found in C-terminal residues 110 to 119 of the neurohormone Metastin (also referred to as Kisspeptin-10); it increases plasma concentrations of GH (Growth Hormone) and LH (Luteinizing Hormone).
Sequence:YNWNSFGLRY-NH2
MW:1318.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-446)

Supplier: Anaspec Inc

Description: This sequence is OVA (ovalbumin) peptide residues 257 to 280, also known as OT-II (OVA-specific T-cell receptor) peptide, the core H2b-restricted class II MHC epitope.
Sequence: AAHAEINEA
MW: 925 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: (103008-528)

Supplier: Anaspec Inc

Description: This peptide is histone H4 (1-21), acetylated at lysine 5, 8, 12, and 16. It contains a C-terminal GG linker, followed by a biotinylated Lys. In general, histone H4 acetylation is associated with increased DNA replication during mitosis, although different combinations of acetylation at specific sites are selective for specific processes. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRG-K(Ac)-GG-K(Ac)-GLG-K(Ac)-GGA-K(Ac)-RHRKV-GGK(Biotin)
MW:2728.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-518)

Supplier: Anaspec Inc

Description: This peptide is derived from amino acid residues 372-389 of human p53 tumor suppressor protein and is acetylated at Lys382. It is biotinylated at its N-terminus through a 6-carbon LC linker. Activated p53 functions to induce cell cycle arrest and apoptosis in response to signals such as DNA damage. Acetylation of p53 reduces ubiquitination by MDM2 and increases p53 half-life in vivo.
Sequence:Biotin-LC-KKGQSTSRHK-K(Ac)-LMFKTEG
MW:2473 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-532)

Supplier: Anaspec Inc

Description: This peptide consists of amino acids 1-23 of histone H4 attached at the C-terminal by a GSGS linker to biotinylated lysine. It is used as a substrate for histone acetyltransferase (HAT) assays. Biotinylation allows the peptide to be captured on streptavidin or agarose beads.
Sequence:SGRGKGGKGLGKGGAKRHRKVLR-GSGSK(Biotin)
MW:3003.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-564)

Supplier: Anaspec Inc

Description: This peptide is the H2-Kd-restricted epitope of Listeriolysin O (LLO), consisting of amino acids 91 to 99. LLO is necessary for Listeria monocytogenes to escape the vacuoles of host cells and enter the cytoplasm during infection. This fragment has been shown to be a potential vaccine candidate against L. monocytogenes by eliciting a CTL response in vivo.
Sequence:GYKDGNEYI
MW:1058.1 Da
% peak area by HPLC:95
Storage condition:-20° C