You Searched For: Anaspec Inc

Description: QXL* 570 C2 maleimide, dyes are optimized quenchers for rhodamines (such as TAMRA, sulforhodamine B, ROX) and Cy3 fluorophores, Purity: >/= 95% by HPLC, MW: 871.88, Spectral Properties: Abs/Em = 577/none nm, Solvent System: DMF or DMSO, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103011-070

Supplier: Anaspec Inc

Sale

Description: HiLyte* Fluor 488 C2 maleimide, thiol-reactive fluorescent labeling dye, that generates the protein conjugates, Molecular Weight: 567.55, Spectral Properties: Abs/Em = 502/527 nm, Solvent System DMF or DMSO, Physical State: Solid, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103010-882

Supplier: Anaspec Inc

Sale

Description: 520 MMP FRET Substrate XII, Purity: >/= 95%, MW: 2125.4, Sequence: (One-Letter Code): 5-FAM-RPKPYA-Nva-WM-K(QXL* 520)-NH2for assaying MMP-1, 2, 7, 8, 12 and 13 activities, Abs/Em = 494/521nm, Appearance: Lyophilized red powder, Size: 0.1 mg

Catalog Number: 103005-938

Supplier: Anaspec Inc

Sale

Description: Hyaluronan Inhibitor, Sequence: GAHWQFNALTVR, Purity: By HPLC >/= 95%, 12 amino acids peptide is a hyaluronan inhibitor, high molecular weight glycosaminoglycan expressed abundantly in the extracellular matrix and on cell surfaces, Molecular Weight: 1399.6, Size: 1 mg

Catalog Number: 103007-428

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 520 Factor Xa Assay Kit *Fluorimetric*, Components: 5-FAM/QXL*-520 Factor Xa substrate 0.6 mM, 50 uL, 5-FAM 0.6 mM, 10 uL, Purified Bovine Factor Xa 500 ng/uL, 20 uL, 2X Assay Buffer 25 mL, Factor Xa Inhibitor 1 mM, 20 uL, storage: -20 deg C

Catalog Number: 103010-624

Supplier: Anaspec Inc

Sale

Description: Tetradecapeptide Renin Substrate, Angiotensinogen (1-14), rat, Purity: By HPLC >/= 95%, derived from rat angiotensinogen amino acid residues 1-14. It is a synthetic renin substrate, Molecular Weight: 1823.1, Size: 1 mg

Catalog Number: 103007-788

Supplier: Anaspec Inc

Sale

Description: Rat Renin Recombinant, Concentration: 0.5 mg/mL, Renin, a protease secreted by the kidney, plays a key role in the renin-angiotensin system, Renin acts by converting the renin substrate, angiotensinogen, to angiotensin I in the blood, Storage: -80 deg C, Size: 20 ug

Catalog Number: 103010-484

Supplier: Anaspec Inc

Sale

Description: MAGE-3 (271-279) HLA-A*0201-restricted peptide derived from melanoma antigens encoded by MAGE-3, Purity: HPLC greater than or equal to 95%, Sequence (One-Letter Code): FLWGPRALV, Molecular Weight: 1016.2, Physical State: Powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-588

Supplier: Anaspec Inc

Sale

Description: [Lys(Me3)20]-Histone H4 (8-30)- WGK; H4K20(Me3) (8-30), Purity: HPLC >/= 95%, MW: 3184.7, Sequence: [Ac-KGLGKGGAKRHR-K(Me3)-VLRDNIQGITWG-K(biotin)] amino acid residues 8-30 with a C-terminal WG linker followed by a biotinylated lysine. Store: -20 deg C, Size: 1mg

Catalog Number: 103009-616

Supplier: Anaspec Inc

Sale

Description: Autocamtide-2 [KKALRRQETVDAL], Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 1527.8, Sequence: (One-Letter Code) KKALRRQETVDAL, native peptide is a selective substrate for Ca2+/CaMK, Appearance: White powder, Storage: At -20 degree C, Size: 5mg

Catalog Number: 103003-034

Supplier: Anaspec Inc

Sale

Description: alpha-Mating Factor Pheromone, yeast, Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 1684, Sequence: WHWLQLKPGQPMY, tridecapeptide, an alpha-factor pheromone of Saccharomyces cerevisiae, induces conjugation, Storage: At -20 degree C, Size: 5mg

Catalog Number: 103003-004

Supplier: Anaspec Inc

Sale

Description: Secretin, rat, Purity: HPLC >/- 95%, Molecular Weight: 3028.7, Sequence: HSDGTFTSELSRLQDSARLQRLLQGLV-NH2, is a 27-amino acid gastrointestinal peptide hormone, has been implicated in numerous regulatory events involving the pancreas, biliary tree, stomach, Size: 1 mg

Catalog Number: 103003-340

Supplier: Anaspec Inc

Sale

Description: Histone H3 (21-44)-GK(Biotin), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2917.5, Sequence: ATKAARKSAPATGGVKKPHRYRPG-GK(Biotin), Label: Biotin, peptide derived from Histone H3 21-44 amino acids, Storage: -20 degree C, Size: 1mg

Catalog Number: 103008-160

Supplier: Anaspec Inc

Sale

Description: Atrial Natriuretic Peptide(1-28), Purity: HPLC >/= to 95%, Molecular Weight: 3080.5, Sequence: H-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-GlyAla-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe, Appearance: Lyophilized white powder, Size: 0.5 mg

Catalog Number: 102996-074

Supplier: Anaspec Inc

Sale

Description: 5 - TAMRA, Special Formulation, purified single isomer, Synonym: 5-Carboxytetramethylrhodamine, Molecular Weight: 430.45 (Free Acid), Spectral Properties: Abs/Em = 541/568 nm, Solvent System: DMF or DMSO, Appearance: Dark red solid, Storage -20 deg C, Size: 10mg

Catalog Number: 103010-834

Supplier: Anaspec Inc

Sale

Description: Growth Hormone Releasing Factor, GRF (1-29), amide, human, Purity: HPLC >/= to 95%, Molecular Weight: 3357.9, Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2, this peptide was isolated from human hypothalamic-hypophysial tissues, Size: 0.5 mg

Catalog Number: 102996-318

Supplier: Anaspec Inc

Sale