You Searched For: Anaspec Inc

Description: HiLyte™ Fluor 647 acid fluorescent dye

Catalog Number: 103010-190

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Anti-Human MOG (1-125) Human IgG Specific ELISA Kit, Optimized to detect anti-human MOG (1-125) IgG in human samples, Wells are pre-coated with recombinant human MOG, Storage: At 2-8 degree C, Size: One 96-well strip plate

Catalog Number: 103001-242

Supplier: Anaspec Inc

Sale

Description: FITC (fluorescein-5-isothiocyanate, fluorescein isothiocyanate isomer I)

Catalog Number: 102998-068

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (42-1), Human, Sequence: AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD, Purity: Peak Area By HPLC greater than or equal to 95%, Molecular Weight: 4514.1, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 0.1 mg

Catalog Number: 103000-624

Supplier: Anaspec Inc

Sale

Description: Elastin, FITC Conjugated, soluble bovine neck ligament elastin, heavily labeled with FITC, conjugate's fluorescence is quenched, Spectral property : Abs/Em = 492/515 nm, Solvent System: Water, Fluorescence: Excitation/Emission wavelength= 490 nm/520 nm, Size: 1 mg

Catalog Number: 103011-296

Supplier: Anaspec Inc

Sale

Description: SensoLyte* 390 Cathepsin D Assay Kit *Fluorimetric*, Components: Mca/Dnp, Cathepsin D substrate, 1.6 mM, 50 uL, Mca fluorescence reference standard 2 mM, 10 uL, Cathepsin D, 0.1 mg/mL, 20 uL, Assay Buffer 20 mL, Pepstatin A 4 mM, 100 uL, DTT 1 M, 100 uL

Catalog Number: 103010-418

Supplier: Anaspec Inc

Sale

Description: Tau Peptide (337-368) (Repeat 4 domain), Purity: HPLC >/= 95%, Molecular weight: 3467.86, Sequence: VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN] TAU proteins belong to the microtubule-associated protein (MAP) family, Store: -20 deg C, Size: 1mg

Catalog Number: 103009-746

Supplier: Anaspec Inc

Sale

Description: Human [NMeG24, NMeI26] Islet Amyloid Polypeptide (22-27)

Catalog Number: 103007-100

Supplier: Anaspec Inc

Sale

Description: Human Beta-Amyloid (1-42), Biotin

Catalog Number: 103006-798

Supplier: Anaspec Inc

Sale

Description: Saccharomyces cerevisiae alpha-Mating Factor Pheromone

Catalog Number: 103003-004

Supplier: Anaspec Inc

Sale

Description: MAGE-3 (271-279)

Catalog Number: 103006-588

Supplier: Anaspec Inc

Sale

Description: Rat Recombinant Renin (from HEK293 Cells)

Catalog Number: 103010-484

Supplier: Anaspec Inc

Sale

Description: Rat Angiotensinogen (1-14)

Catalog Number: 103007-788

Supplier: Anaspec Inc

Sale

Description: Rat Secretin

Catalog Number: 103003-340

Supplier: Anaspec Inc

Sale

Description: Beta - Amyloid (1 - 42), Human, a major component of amyloid plaques, Purity: % Peak Area By HPLC >/=95%, Peptide Content: >/=60%, Appearance: Lyophilized white powder, Molecular Weight: 4514.1, Storage: -20 deg C, Size: 1mg

Catalog Number: 102998-162

Supplier: Anaspec Inc

Sale

Description: Human Beta-Amyloid (11-17)

Catalog Number: 103007-748

Supplier: Anaspec Inc

Sale