Print…

You Searched For: Anaspec Inc


2,094  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"2094"

Rate These Search Results

Image Unavailable-103007-656

[Lys(Ac)14]-Histone H3 (9-19) H3K14(Ac) 1 mg

Description: [Lys(Ac)14]-Histone H3 (9-19), H3K14(Ac), Sequence: KSTGG-K(Ac)-APRKQ, Purity: By HPLC greater than or equal to 95%, H3 peptide acetylated at the lysine residue at the 14th position, Molecular Weight: 1199.4, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-656
Supplier: Anaspec Inc
Image Unavailable-102999-380

Omega - Conotoxin GVIA 0.5 mg

Description: Omega - Conotoxin GVIA, Sequence: CKS(Hyp)GSSCS(Hyp)TSYNCCRSCN(Hyp)YTKRCY - NH2, Purity: HPLC greater than or equal to 95%, neurotoxin that blocks N-type calcium channels, Molecular Weight: 3037.4, Apperance: Lyophilized white powder, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102999-380
Supplier: Anaspec Inc
Image Unavailable-102996-112

Gastrin-1 1 mg

Description: Gastrin-1, rat, Purity: HPLC >/= 95%, Molecular Weight: 2126.3, Sequence: Pyr-Arg-Pro-Pro-Met-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-NH2, Appearance: Powder, Storage: -20 deg C, Size: 1mg
Catalog Number: 102996-112
Supplier: Anaspec Inc
Image Unavailable-102999-382

Omega - Conotoxin GVIA 1 mg

Description: Omega - Conotoxin GVIA, Sequence: CKS(Hyp)GSSCS(Hyp)TSYNCCRSCN(Hyp)YTKRCY - NH2, Purity: HPLC greater than or equal to 95%, neurotoxin that blocks N-type calcium channels, Molecular Weight: 3037.4, Apperance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102999-382
Supplier: Anaspec Inc
Image Unavailable-103003-250

520 MMP FRET Substrate VII 0.1 mg

Description: 520 MMP FRET Substrate VII, Purity: HPLC >/- 95%, Molecular Weight: 1963.1, Sequence: QXL* 520-Pro-Leu-Gly-Met-Trp-Ser-Arg-Lys(5-FAM)-NH2, A sensitive substrate for assaying MMP-2 and 13 activities, Abs/Em = 494/521 nm, Storage: -20 deg C, size: 0.1 mg
Catalog Number: 103003-250
Supplier: Anaspec Inc
Image Unavailable-103007-346

Beta - Amyloid (17 - 28) 1 mg

Description: Beta - Amyloid (17 - 28), Human, mouse/rat, Sequence: LVFFAEDVGSNK, This peptide is amino acids 17 to 28 fragment of beta-amyloid, Molecular Weight: 1325.5, Apperance: Powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-346
Supplier: Anaspec Inc
Image Unavailable-102996-538

Endothelin 3 0.5 mg

Description: Endothelin 3, human, rat, Purity: HPLC >/= 95%, Molecular Weight: 2643.1, Sequence: CTCFTYKDKECVYYCHLDIIW, Appearance: Lyophilized white powder, is a member of a family of potent vasoconstrictors namely, Endothelin and Sarafotoxin, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102996-538
Supplier: Anaspec Inc
Image Unavailable-102999-618

Cys - beta - Amyloid (1 - 42) 0.1 mg

Description: Cys - beta - Amyloid (1 - 42), Human, Sequence: CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4617.3, Apperance: Powder, Storage: -20 deg C, Size: 0.1 mg
Catalog Number: 102999-618
Supplier: Anaspec Inc
Image Unavailable-103009-362

[Arg(Me2a)3]-Histone H4

Description: [Arg(Me2a)3]-Histone H4 (1-23)-GGK, Purity: HPLC >/= 95%, MW: 2857.4, Sequence: [SG-R(Me2a)-GKGGKGLGKGGAKRHRKVLRGG-K(Biotin)] asymmetrically dimethylated at Arg3 followed by a biotinylated Lys conjugated to a C-terminal GG linker. Store: -20 deg C, Size: 1mg
Catalog Number: 103009-362
Supplier: Anaspec Inc
Image Unavailable-103010-654

Recombinant DJ-1 (PARK7) Protein 100 ug

Description: Recombinant DJ-1 (PARK7) Protein, Human, GST tagged (GST-DJ-1), Purity: >95% SDS-PAGE, MW: 47.3kDa, The recombinant DJ-1 protein was purified from bacterial lysate using GST affinity chromatography, Applications: ELISA, WB, Protease Activity, size: 100 ug
Catalog Number: 103010-654
Supplier: Anaspec Inc
Image Unavailable-103007-974

[Lys(Me1)9]-Histone H3 (1-21)-GGK(Biotin) H3K9(Me1) 1 mg

Description: [Lys(Me1)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Me1), biotin-labeled, Sequence: ARTKQTAR-K(Me1)-STGGKAPRKQLA-GGK(Biotin), Purity: By HPLC >/= 95%, Residues 1 to 21 mono-methylated at Lys-9, Molecular Weight: 2737.2, Size: 1 mg
Catalog Number: 103007-974
Supplier: Anaspec Inc
Image Unavailable-103007-108

Beta - Amyloid (1 - 40) - Lys(LC - biotin) - NH2 0.1 mg

Description: Beta - Amyloid (1 - 40) - Lys(LC - biotin) - NH2, FAM - labeled, Human, FABB, Purity: By HPLC greater than or equal to 95%, biotinylated on the lysine side chain, Molecular Weight: 5154.9, Storage: -20 deg C, Size: 0.1 mg
Catalog Number: 103007-108
Supplier: Anaspec Inc
Image Unavailable-103011-400

Calcein, AM 200 uL

Description: Calcein, AM *UltraPure Grade*, 5 mM solution in anhydrous DMSO, CAS no: 148504-34-1, Purity: >/= 95% HPLC, cell-permeant and non-fluorescent compound that is widely used for determining cell viability, Molecular Weight: 994.9, Spectral Properties: Abs/Em = 494/517 nm, Size: 200ul
Catalog Number: 103011-400
Supplier: Anaspec Inc
Image Unavailable-103010-002

Protease-Activated Receptor-1, PAR-1 Agonist, amide

Description: Protease-Activated Receptor-1, PAR-1 Agonist, amide MW: 883, Sequence: AF(para-Fluoro)R-Cha-Cit-Y-NH2] This peptide is PAR-1 selective agonist displaying a high level of specificity to PAR-1 over PAR-2. Store: -20 deg C, Size: 1mg
Catalog Number: 103010-002
Supplier: Anaspec Inc
Image Unavailable-103008-326

[Lys(Me1)18]-Histone H3 (1-21)-GGK(Biotin) H3K18(Me1) 1mg

Description: [Lys(Me1)18]-Histone H3 (1-21)-GGK(Biotin), H3K18(Me1), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2736.2, Sequence: ARTKQTARKSTGGKAPR-K(Me1)-QLA-GGK(Biotin)-NH2, Label: Biotin, 0, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-326
Supplier: Anaspec Inc
Image Unavailable-103011-256

RH414 5 mg

Description: RH414, Synonym: N-(3-Triethylammoniumpropyl)-4-(4-(4-(diethylamino)phenyl)butadienyl) pyridinium dibromide, Widely used for functional imaging of neurons, Molecular Weight: 581.5, Spectral Properties: Abs/Em = 532/716 nm, MF: C28H43Br2N3, Form: Solid, Storage: -20 deg C, Size: 5 mg
Catalog Number: 103011-256
Supplier: Anaspec Inc
145 - 160 of 2,094