Print…

You Searched For: Circulators


1,704  results were found

Refine Results Sort by
SearchResultCount:"1704"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-103003-074

Bovine;Human;Pig Glucagon (1-29), FAM-labeled, FAM (Carboxyfluorescein)

Catalog Number: (103003-074)
Supplier: Anaspec Inc
Description: This is a fluorescent (FAM)-labeled Glucagon peptide, Abs/Em=494/521 nm. Glucagon is a peptide hormone secreted from the pancreatic Islet of Langerhans alpha-cells in response to low circulating blood glucose levels in order to restore normal glucose levels. It acts on hepatic enzymes that regulate glucose production and glycogen synthesis. Excessive amounts of circulating glucagon levels is implicated in the metabolic dysregulation of type 2 diabetes, since such conditions result in hyperglycaemia.
Sequence: FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
MW: 3841.1 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Product Image-10400-410

Anti-SLCO2A1 Rabbit Polyclonal Antibody

Catalog Number: (10400-410)
Supplier: Bioss
Description: May mediate the release of newly synthesized prostaglandins from cells, the transepithelial transport of prostaglandins, and the clearance of prostaglandins from the circulation. Transports PGD2, as well as PGE1, PGE2 and PGF2A.
Product Image-10200-026

CFCS2® Cooled Closed Chamber System, Bioptechs Inc.®

Catalog Number: (10200-026)
Supplier: BIOPTECHS INC.
Description: This modified FCS2® Closed Chamber System includes fluid ports in the base to accommodate the circulation of an external refrigerant.
Image Unavailable-10490-516

Anti-Protein S Rabbit Polyclonal Antibody (Cy5®)

Catalog Number: (10490-516)
Supplier: Bioss
Description: Protein S (PROS) is a vitamin K-dependent plasma protein that inhibits blood clotting by serving as a cofactor for activated protein C (APC) and facilitates clearance of early apoptotic cells. In the plasma, circulating Protein S becomes inactive upon complexing with C4b-binding protein (C4BP); 60-70% of Protein S circulates in complex with C4BP. Calcium-dependent association of C4BP-Protein S with apoptotic cells influences the regulation of complement activation. Protein S has APC-independent anticoagulant activity through direct inhibition of prothrombin activation via interactions with Factor X A, Factor V A and phospholipids. Autosomal dominant Protein S deficiency (levels 15 to 37% of normal) correlates with severe recurrent venous thrombosis.
Image Unavailable-76121-040

Anti-PGCP Rabbit Polyclonal Antibody (Alexa Fluor® 750)

Catalog Number: (76121-040)
Supplier: Bioss
Description: PGCP is a 472 amino acid secreted protein that is primarily detected in blood plasma. PGCP is a carboxypeptidase that potentially is involved in the hydrolysis of circulating peptides. Due to its upregulation in hepatocellular carcinoma (HCC), it is suspected that PGCP may be a potential serological marker for HCC. PGCP is a member of the Peptidase M28 family of proteins, which also includes PSM (prostate-specific membrane antigen), metallopeptidases and aminopeptidases. The gene encoding PGCP maps to chromosome 8, which is made up of nearly 146 million bases and encodes about 800 genes. Translocation of portions of chromosome 8 with amplifications of the c-Myc gene are found in some leukemias and lymphomas, and are typically associated with a poor prognosis. In humans, PGCP is found principally in blood plasma. It is a Carboxypeptidase that may play an important role in the hydrolysis of circulating peptides.
Image Unavailable-89360-444

Anti-CD15 Mouse Monoclonal Antibody [clone: MEM-158]

Catalog Number: (89360-444)
Supplier: Genetex
Description: The CD15 antigen is expressed on approximately 90% human circulating granulocytes (membranes and granules), 30 to 60% of circulating monocytes and is absent from normal lymphocytes. CD15 antigen is also expressed on Reed Sternberg cells of Hodgkin's disease, on T cell lymphomas including mycosis fungoides and on some leukemias. Outside the hematopoietic system, CD15 expression is described in certain normal and neoplastic epithelial cells and in astrocytes. CD15 antibodies recognize the tri saccharide 3 fucosyllactosamine (3Fl) which is present in lacto N fucopentaose III and in the blood group antigen X hapten. At least 5 major CD15 antigens (105, 135, 165, 185, 220 kDa) are present on the surface membranes of polymorphonuclear cells. The hapten occurs also in glycolipids. CD15 plays a role in mediating phagocytosis, bactericidal activity and chemotaxis.
Product Image-102552-620

sTNF-R, 80 kDa, Human ELISA, BioVendor

Catalog Number: (102552-620)
Supplier: BioVendor
Description: This assay will help to clarify the possible diagnostic and prognostic value of circulating sTNF-R (60 kDa) in various neoplastic and inflammatory diseases.
Product Image-470106-160

Aqua-Nursery

Catalog Number: (470106-160)
Supplier: Penn-Plax
Description: Separate Newborn Fish From The Mother Fish Automatically With This Hatchery
Product Image-102552-618

sTNF-R, 60 kDa, Human ELISA, BioVendor

Catalog Number: (102552-618)
Supplier: BioVendor
Description: This assay will help to clarify the possible diagnostic and prognostic value of circulating sTNF-R (60 kDa) in various neoplastic and inflammatory diseases.
Image Unavailable-10339-030

Anti-EPO Rabbit Polyclonal Antibody (Cy5®)

Catalog Number: (10339-030)
Supplier: Bioss
Description: Erythropoietin is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass.
Product Image-89158-838

Raloxifene hydrochloride ≥98% (by TLC)

Catalog Number: (89158-838)
Supplier: Enzo Life Sciences
Description: A selective estrogen receptor modulator (SERM). Displays anti-estrogen action along with anti-androgen action. In clinical use for prevention of postmenopausal osteoporosis. Reduces circulating levels of IL-6 and TNFα. Inhibits prostate carcinogenesis in transgenic rat model. May be useful for the prevention of hormone-related cancers.
Product Image-76333-932

Water Bath Protective Agent, polyclear MIX 30 PLUS, PolyScience

Catalog Number: (76333-932)
Supplier: Polyscience
Description: General purpose fluid that prevents algae growth and premature rust formation. Ideal for use in heating baths, circulators, water baths and shaking water baths.

Certificates


Image Unavailable-H-8740.0500BA

Exendin (9-39) Acetate

Supplier: Bachem Americas
Description: Exendin (9-39) is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. It has also been described as an antagonist of the putative exendin receptor. Exendin (9-39) blocks the stimulatory action of GLP-1 (7- 36) amide (H- 6795) and of exendin-4 (H- 8730) on cAMP production in pancreatic acini. Moreover, exendin (9-39) was shown to be safely used to abolish the incretin effect of GLP-1 without interfering with the control of insulin secretion by circulating nutrients.

Image Unavailable-10405-654

Anti-SLCO2A1 Rabbit Polyclonal Antibody (Cy3®)

Catalog Number: (10405-654)
Supplier: Bioss
Description: May mediate the release of newly synthesized prostaglandins from cells, the transepithelial transport of prostaglandins, and the clearance of prostaglandins from the circulation. Transports PGD2, as well as PGE1, PGE2 and PGF2A.
Image Unavailable-10490-524

Anti-Protein S Rabbit Polyclonal Antibody (HRP (Horseradish Peroxidase))

Catalog Number: (10490-524)
Supplier: Bioss
Description: Protein S (PROS) is a vitamin K-dependent plasma protein that inhibits blood clotting by serving as a cofactor for activated protein C (APC) and facilitates clearance of early apoptotic cells. In the plasma, circulating Protein S becomes inactive upon complexing with C4b-binding protein (C4BP); 60-70% of Protein S circulates in complex with C4BP. Calcium-dependent association of C4BP-Protein S with apoptotic cells influences the regulation of complement activation. Protein S has APC-independent anticoagulant activity through direct inhibition of prothrombin activation via interactions with Factor X A, Factor V A and phospholipids. Autosomal dominant Protein S deficiency (levels 15 to 37% of normal) correlates with severe recurrent venous thrombosis.
Image Unavailable-10490-518

Anti-Protein S Rabbit Polyclonal Antibody (Cy5.5®)

Catalog Number: (10490-518)
Supplier: Bioss
Description: Protein S (PROS) is a vitamin K-dependent plasma protein that inhibits blood clotting by serving as a cofactor for activated protein C (APC) and facilitates clearance of early apoptotic cells. In the plasma, circulating Protein S becomes inactive upon complexing with C4b-binding protein (C4BP); 60-70% of Protein S circulates in complex with C4BP. Calcium-dependent association of C4BP-Protein S with apoptotic cells influences the regulation of complement activation. Protein S has APC-independent anticoagulant activity through direct inhibition of prothrombin activation via interactions with Factor X A, Factor V A and phospholipids. Autosomal dominant Protein S deficiency (levels 15 to 37% of normal) correlates with severe recurrent venous thrombosis.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
241 - 256 of 1,704
no targeter for Bottom